nuoH2

NADH-quinone oxidoreductase subunit H 2

394 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

44.177 kDa

MMEWWNSLSPTVQVWLGGVLKASLILVWGLINFYLCLMLERKLSAWMQNRVGPWRVGLWGWIQPVADLIKLWVKEYIRPNNVDKWLYLIAPFIGFVSANLVWLIVPFGDKLIATDFEIGIIFIAAVMGYDVIATFMAGWGSNNKYSMLGAMRGAAQLISYEVTMVMAVIGVVMMAGSLRLSDIVLAQQQRGFLGWFLFPQIIGFIVYLIASLAELNRAPFDLAEAEQELVAGHHTEYSGFRWAMFMLAEYIHLAAWSAIAATLFLGGWSGPTLGQVAAGLGNVLNGFGAFTNPVGTAVLNWGLAISGSTILNWVAGVFWLVLKTYFFVFLAMWIRWTLPRVRIDQLMDLGWKFLLPVSMFNIFLTGTLRYLAVAFDGVPISIGSFTLRLLGWWL

nuoH2

NADH-quinone oxidoreductase subunit H 2

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

42.911 kDa

METVLNHPLFMPVLVTLVIIAAFPLVAGYIVLVERKVLADFQVRLGPMRCGPHGLLQPIADALKLLLKEDIIPTDSDKAIFWFAPCISTITGLVAFAVIPFARKIYVADVNVGLLVISATSAVGILGIILGGWSSNSHYSLLGALRSAAQLVSYEVALAFALLSGVMVAGTLSMQGIVQSQADRGVWGIFANYGFMVVPFVLYIIAATAETNRAPFDLPEAESELVAGFHTEYSGFRWALYFLAEYANIFVISSVAVTLFWGGWLRPFSSVAWLEKPLNYGVPVILFVGSGLLTFTLIRKVVDPMQQKVLLGVVVLLVLIGAIMAIPMVNDAMIGLFWFLVKVSVIIYTMIWFRGTFPRYRYDQLMNIGWKIAIPVGMASVMVNAVLGMLGKH

nuoH2

NADH-quinone oxidoreductase subunit H 2

366 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.531 kDa

MEYAQQLFGDFFGPEWGPALFLLVKNVLLIVAIVLPLMLAVAYLTFAERKIIGYMQLRVGPNRVTFFGIPWLGGWAQPIADAVKAVMKEIIIPSGANKVLFVLAPILTFAPALAAWAVIPFSPDVVLADINAGLLYILAMTSMGVYGIIIAGWASNSKYAFLGAMRSAAQVVSYELAMGFALVCVLMMSQSLNLGDIVKGQQGASMLNWYLIPLFPMFLVYFISGVAETNRAPFDVAEGESEIVAGFHVEYSGMAFTVFFLAEYSNMILVAMLASIIFLGGWLPPVNVAPFTLVPGFIWLILKASFLLFCFLWFRATFPRYRYDQIMRLGWKVFIPITLVWIVVLGLVMQLPASIRGAFPLNLWFH

nuoH2

NADH-quinone oxidoreductase subunit H 2

365 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

40.705 kDa

MFVVLFVLTLILLYAVFVVWAERKVAAFIQDRLGPMEVGPYGMLQTIADLIKLLQKEDIIATGANRFLFRLAPVLIFTAIFAGFATLPFAPDLIGSKADVGVFFMITIVSLDVVGIFLAGWASNNKFSILGAFRAIAQVISYEIPLTLSILAVVLICQTLDLQEISFQQGIYFVNKQELNTSLFGITSLGIDVNKIGGFVSWNAFKYPFLLLAYVVFFIASLAECNRAPFDIPEGESELVSGFHTEYTGFRFAILFLAEYAMMLLVAFLGVVLFFGSWNTALPNIGSLHFADWTSGTPGTIAGYAWGLFWLISKGITVVFLQLVMRWTYPRLRVDQLMNLCWKILLPLSLFLVIVSGVWVVWMKI

nuoH2

NADH-quinone oxidoreductase subunit H 2

354 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.997 kDa

MGSIALFLLVALIKVVLVIFVLLTAVAYTVWLERKVVGRMQNRWGPTRVGPFGLLQPLADGLKFILKEDLLPPHVNKPLYILAPMLAVAMALLSISIVPFGGTLTIGHITTPLQITGIMGANGQPVDINIGLLIILGVTSIGVYGIALAGWSSNSKYSLLGSLRASAQMVSYEVSLGLSLVGVLLLSGSFSLREIVRLQQGGFWNWNIFGGFQFIAFFIYLTSAYAETNRIPFDLPEAETELVAGYHTEYSSMKFAMFFMAEYANMVTVACIASILFLGGWSGPVPGFLPPILQSLVPVFWFCLRIFAFLFIYIWVRGTLPRFRYDQLMAFSWKFLLPLSIANIMVTALFVALK

nuoH2

NADH-quinone oxidoreductase subunit H 2

346 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.483 kDa

MGYEILGLPMAYYIAMVLKVLVVFVFVLLTVAYATYAERKIIGHMQVRLGPMRTGWHGLLQPIADGVKLFFKEEIIPSKADKFAFLIAPLIALVPAFIGFAVIPFGETIEVGGYKIPLQIAAYYDTASGQVVDLNVGVLYILALASIGVYGIVLAGWSSNSKYSLLGGLRSSAQMISYELAAGLAIISVFMLSESLSLQKIVADQANGAWYAFKQPLAFILFFICSIAEINRTPFDLPEAETELVSGFCTEYSSMKYAMFFMAEYANMVTVCAVTTTLFLGGWHGPSFLPGWFWFIAKVYFLIFTCMWIRATYPRYRYDQLMRLGWKVFLPLTLINIVVTGIIVSL

nuoH2

NADH-quinone oxidoreductase subunit H 2

344 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

38.24 kDa

MFDFLPSSLQVTLPILFKIVAIVLPLILIVAWLTFAERKIIGYMQGRIGPNRVGPRGWLQPIADTVKLLLKEIIIPASANRILFLLAPVLAIAPALAVWAVIPFDAHLVLADINAALLYILAIGSMSVYGIILAGWASNSKYAFLGAMRSAAQVVSYEIAMGFALVGVLIAGGSLNLGEIVQAQEGGFWHWFWLPLFPLFLIYFISGVAETNRLPFDVAEGESEIVAGFHVEYSGMAFALFFLAEYIEMILVSTLAALMFLGGWLSPFQGTVLEAIFEWVPGIVWLLIKTAIFLFFYLWFRATFPRYRYDQIMRLGWKVFIPITIVWLLVVGGARVAQLGPWFT

nuoH2

NADH-quinone oxidoreductase subunit H 2

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.465 kDa

MAEFFATNLWPLIIVIGQSVLLLVLLLISIAYILLADRKIWAAVQLRRGPNVVGPWGLLQSFADLLKFVVKEPTVPSGANKGVFLLAPLVTCVLALAAWAVIPVNAGWVIADINVGVLYILAVSSLSVYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVVICVLLCVGSLNLTAIVEAQNSQWGMLGWYWLPLFPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYSSTPYLLFMLGEYVAIVTMCAMGTILFLGGWLPPVPYAPFTWVPGIVWFALKVLFMFFLFAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVAAVLQFAGLAPK

nuoH2

NADH-quinone oxidoreductase subunit H 2

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.513 kDa

MADFFMTNLWPLIVVIGQSVLLIVVLLISIAYILLADRKIWAAVQIRRGPNVVGPWGLLQSFADLLKMILKEPMIPSGANKGVFLLAPLVTCVLALSAWAVIPVSAGWVIADINVGVLYILAVSSLSVYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVIICVLLCVGSLNLTAIVQAQNSQWGVLGWYWLPLFPMFVVFYVSALAETNRPPFDLVEAESELVAGFMVEYSSTPYMLFVLGEYVAIVTMCAMGTILFLGGWLPPVPYAPFTWVPGIVWFALKVLFMFFMFAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVAAVLQFAGLAPK

nuoH2

NADH-quinone oxidoreductase subunit H 2

341 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.475 kDa

MADLWTNYLLPLLIVIGQSFLLLTVLLITIAYILLADRKIWAAVQIRRGPNVVGPWGLLQSFADLLKMVLKEPTIPSGANKGVFLLAPLVSCVLALAAWAVIPVDAGWMIADINVGVLYILAVSSLSVYGIIMAGWSSNSKYPFLAALRSAAQMVSYEVSIGFVIVCVLLCAGSLNLTAIVEAQNSQYGLLGWYWLPLFPVFVIFYVSALAETNRPPFDLVEAESELVAGFMVEYASTPYMLFVLGEYVAIATMCAMGAIMFLGGWLPPLPIAPFTWVPGVIWFTLKLFFMFFMFAMAKAIVPRYRYDQLMRLGWKVFLPLSLAMVVIVASVLQFAGLAPK

nuoH2

NADH-quinone oxidoreductase subunit H 2

340 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

37.869 kDa

MNKWPRIMELIVAFGLIVFKVALLIAILLLLPLPLTWLERKIAGHMQQRMGPMRVGWHGLLQPVADGIKLLTKEDHIPAEADRFLFKLAPILALAPPFVVFVAIPFGETISVRGTEITLYLSNMNVALLFVFAVIGIEVFGVIFGGWAANSKYAVLGSLRTCAQMISYEIPMGFAVIGVVMLAQSMSLLDIVRAQTDVWNIVYQPVGFFVFFVAGLAEAQRIPFDLAEAEGDLGAGFHTEYSGIRFAFFMVSEYVIVLLVSVLLVILFFGGWNGILVPMPPLLWFLLKVAFFVYLFIWFRFTFPRYRYDQLMAIGWKVLLPLSMANIIITGVLLGAAAAP

nuoH2

NADH-quinone oxidoreductase subunit H 2

331 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.296 kDa

MLNWTAGFLVLIAKLTIVLAVLLLVAAYLVWLERKFLARLQIRYGPNRAGKFGLLQPIADIVKMVAKEDTVPEGAERTIFMLAPAVVAATALLVFAVIPFGKDVTLWGMKIPLVVADLNVGLLYFFALSSLGVYGVALGGWASNSKYSLLGGIRGAAQMISYELSLGLAIVPVVMQARSFSLVDIVQAQEKYPFILTQPVAFAIFVISAMAEIKRIPFDLPEAENELGAGFHTEYSGMRFGLFFLGEYVNMQVLGGLVAVLFLGGWHGPLLPPVVWLFIKIVLVALIMIWVRGTLPRLRYDQLMALGWKVLIPLALVNIMVTGAWVLWMGK

nuoH2

NADH-quinone oxidoreductase subunit H 2

329 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.087 kDa

MNGVALDIAIHGAKIALIFFVVLTLAAYLVFAERRLLAWIQDRKGPNRVGPFGLLQPLADLIKLLTKEDFRPAGADKWLFYLAPAMAAVPAILTFAVIPFGAPVTILGREIPLQVADLNVGLLFFLALSSIAVYGVALGGWASNSKYALLGSIRGLAQLISYELSMGLSLVPTVMLAGSLRLSDIVAAQEGVWFIAYQPVAFLIFLISIAAECKRIPFDIPEAEGELVAGFHTEYSGMRFGLFFVGEYINIIVLGGLATTFFLGGWQGPLLPPFVWFSVKTLAFAFFFIWMRGTLPRLRYDQLMHLGWKVLTPLALLNILITGWVLMFV

nuoH2

NADH-quinone oxidoreductase subunit H 2

328 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

36.387 kDa

MELIVALGVIVFKVALVIAILLLLPLPLTWLERKIAGHMQQRMGPMRVGWHGLLQPVADGIKLLTKEDHIPAEADRFLFKLAPILALAPPFVVFAAIPFGESVSVLGNEITLYISNLNVALLFVFAVIGLEVYGVIFGGWAANSKYAVLGSLRTCAQMISYEIPMGFAVIGVVMLAQSMSLLDIVRAQTDVWNVVYQPIGFFVFFVAGLAEAQRIPFDLAEAEGDLGAGFHTEYSGIRFALFMVSEYVVMVLVSVLTVILFFGGWNGVLIPLPPLLWFLLKVAFFVYLFMWFRFTFPRYRYDQLMAIGWKVLLPLSLANIIISGVVFS

nuoH2

NADH-quinone oxidoreductase subunit H 2

324 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

34.707 kDa

MIGMALTAIISTMLIMVLLVVAGTFTWVERRVLGFVQERLGPNRVGPFGFLQWVADTVKILTKEDRPPPGADRVAYILAPMVAATPVLAGFGVVAFGDGLALANIDVGVMFLLGMMGLTVYGVVLGALASHSRFALMGGLRAAAQMLGYEAFLGLSLLGVVMIAGSLSLTEIVHAQRDVWFVLLQPFGAALFCIAGVAAAHRLPFDLPESENDLVAGYLTEYTGMSFGLFFLGEYLAVLLVASLAVTLFFGGWLGPVWLGPYLPGPIWFGLKVGVIALIFIWIRATLPRPRYDQLVRFAWKIALPLALANLLLTGLIVVARSAP

nuoH2

NADH-quinone oxidoreductase subunit H 2

319 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

34.127 kDa

MIGMIITATISVALIMVLLVLAGTFTWVERRLLGFVQERYGPNRVGPFGSLQWVADTVKILTKEDRPPPGADKLLYILAPAVAATPVLAGFGVVAIGDGWALSSVDVGLLFLLGMLGLTAYAAVLGAWASNNRFSLLGGMRAAAQMLAYEVFLGLSLMGVVMIAGSFSMAEIVEAQRGVWFVVLQPLGMALFTIAGIAAAHRLPFDLPESENDLIAGFITEYTGMSFGLFFLGEYLAVLLVSALAVTLFFGGWLGPWLPGPVWFGLKTAVIAVAFVWIRATLPRPRYDQLLSFAWKVALPLSLLNLMLTGIVVVARSAS

nuoH2

NADH-quinone oxidoreductase subunit H 2

318 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

34.049 kDa

MSVLLIALFSLILLLALLGAAGVFTWGERRLLGFLQERLGPNRVGPFGFLQWVADTLKLLTKEDAPPAGADLAAYRLAPALAAFPMLAGFGVVAFAPRLVISDLDVGVLFVMGMLALTVWALVLGAWGSRNRYAMLGGLRAAAQMLAYESFLGLSLMGCVLLAGSFRMGDIVAAQEGGLWFILLQPLGAALFFLAGLAAAHRLPFDLQESEQDLVAGFMTEYSGMSFALFFLGEYLAILLVAALFTTLFLGGWAGPILPGPVWFGLKVAAISVVFVWLRAALPRPRYDQLISFAWKVALPLALLNLLVTAWIAVGRAA

nuoH2

NADH-quinone oxidoreductase subunit H 2

318 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.

Belongs to the complex I subunit 1 family.

34.063 kDa

MSVLLIALFSLILLLALLGAAGVFTWGERRLLGFLQERLGPNRVGPFGFLQWVADTLKLLTKEDAPPAGADLAAYRLAPALAAFPMLAGFGVVAFAPRLVISDLDVGVLFVMGMLALTVWALVLGAWGSRNRYAMLGGLRAAAQMLAYESFLGLSLMGCVLLAGSFRMGDIVAAQEGGLWFILLQPLGAALFFLAGLAAAHRLPFDLQESEQDLVAGFMTEYSGMSFALFFLGEYLAILLVAALFTTLFLGGWAGPILPGPIWFGLKVAAISVVFVWLRAALPRPRYDQLISFAWKVALPLALLNLLVTAWIAVGRAA