About Products Protein Database Contact

Protein expression services for nuoH2 | NADH-quinone oxidoreductase subunit H 2

Description
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. This subunit may bind ubiquinone.
Family
Belongs to the complex I subunit 1 family.
Species
Symbiobacterium thermophilum (strain T / IAM 14863)
Length
394 amino acids
Sequence
MMEWWNSLSPTVQVWLGGVLKASLILVWGLINFYLCLMLERKLSAWMQNRVGPWRVGLWGWIQPVADLIKLWVKEYIRPNNVDKWLYLIAPFIGFVSANLVWLIVPFGDKLIATDFEIGIIFIAAVMGYDVIATFMAGWGSNNKYSMLGAMRGAAQLISYEVTMVMAVIGVVMMAGSLRLSDIVLAQQQRGFLGWFLFPQIIGFIVYLIASLAELNRAPFDLAEAEQELVAGHHTEYSGFRWAMFMLAEYIHLAAWSAIAATLFLGGWSGPTLGQVAAGLGNVLNGFGAFTNPVGTAVLNWGLAISGSTILNWVAGVFWLVLKTYFFVFLAMWIRWTLPRVRIDQLMDLGWKFLLPVSMFNIFLTGTLRYLAVAFDGVPISIGSFTLRLLGWWL
Mass
44.2 kDa
Simulated SDS-PAGE
Western blot of nuoH2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nuoH2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here