nuoA

NADH-quinone oxidoreductase subunit A

211 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

22.78 kDa

MTSAFNWSALAFILAAIGLVIFMLVVPRLLGGRSQGTEKEEVFESGVVGAGNARIRLSAKFYLVAIFFVIFDLEALYLYAYSVSVREVGWIGYATALIFVVDLLIGLIYALSLGALNWAPADKRRKKERLSAAPAGFNLASITKFNGIDELHTDPTGKVPAQSSGQVNVSNDIEANKRHLANIDRINVTGNVTSVDFSTQSTNSLSNKSSS

nuoA

NADH-quinone oxidoreductase subunit A

207 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

22.488 kDa

MSAFNWSAIAFILAAIALVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKFYLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPADKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQNIDHINTTGNVTSVDFATSAQTDNIKR

nuoA

NADH-quinone oxidoreductase subunit A

207 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

22.406 kDa

MSAFNLSAIAFILAAIGLVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKFYLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPADKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQNIDHINTTGNVTSVDFATSAQTDKMTR

nuoA

NADH-quinone oxidoreductase subunit A

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

20.052 kDa

MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWATSVREVGWMGFTTMVIFVVDLLIALIYVFATGALTWSPSDRRKAAGIKPKIGSPNMNIAEITRFNSIEELVIDPTGHIPAQSSGRMKSKTSTAPSSKQE

nuoA

NADH-quinone oxidoreductase subunit A

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

19.98 kDa

MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFVVDLLIALVYAFSVGALSWAPADRRKLAGEKIKVGSPTMNIAEITRFNSIEELVTDPTGQIPAQSSGRVKSKTTPALSSEKE

nuoA

NADH-quinone oxidoreductase subunit A

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

19.98 kDa

MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFVVDLLIALVYAFSVGALSWAPADRRKLAGEKIKVGSPTMNIAEITRFNSIEELVTDPTGQIPAQSSGRVKSKTTPALSSEKE

nuoA

NADH-quinone oxidoreductase subunit A

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

19.98 kDa

MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFVVDLLIALVYAFSVGALSWAPADRRKLAGEKIKVGSPTMNIAEITRFNSIEELVTDPTGQIPAQSSGRVKSKTTPALSSEKE

nuoA

NADH-quinone oxidoreductase subunit A

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

19.966 kDa

MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFVVDLLIALVYAFSVGALSWAPADRRKLAGEKVKVGSPTMNIAEITRFNSIEELVTDPTGQIPAQSSGRVKSKTTPALSSEKE

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.404 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAVIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

18.376 kDa

MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRIGALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR

nuoA

NADH-quinone oxidoreductase subunit A

150 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.562 kDa

MSTTTEVIAHHWAFAVFLIGAIGLCGLMLLGAFFLGGRARARAKNVPYESGIDSVGSARMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEATIFILVLLAGLVYLVRIGALDWTPGRSNRRVSKPSIVKYASSHPDIPKN

nuoA

NADH-quinone oxidoreductase subunit A

150 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.605 kDa

MSMSTTTEVIAHYWAFAVFLIGALGLCSLMLLGARYLGGRAQARAKHVPYESGLDSVGSARLRMSAKFYLVAMFFVIFDVEALFLYAWAVSVREVGWLGFIEAAVFIAILLAGLFYLVRIGALNWTPVRSRRETAGKSHVRLTSGKHPQQ

nuoA

NADH-quinone oxidoreductase subunit A

149 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.472 kDa

MSMSTSTELFAHHWAFAVFLLGAFGLCALMLLGAFFLGGRAKARAKHVPYESGIDSVGSARLRMSAKFYLVAMFFVIFDVEALFLYAWSVSIKESGWLGFIEASIFILVLLAGLFYLVRIGALNWTPSRSSRQVSKPSVVININNSHPQ

nuoA

NADH-quinone oxidoreductase subunit A

149 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.712 kDa

MSMSTSTEVIAHHWAFGIFLIVAIGLCCLMLVGAWFLGGRARARYKNTPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSVREVGWLGFIEAAIFILVLLAGLVYLVRIGALEWTPSRSRRERLNTEEAGSLTNRHTQ

nuoA

NADH-quinone oxidoreductase subunit A

148 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.564 kDa

MRMSTSTEVIAHHWAFAIFLIIAIGLCCLMLVGGWYLGGRARARSKNTPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLYAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDWTPARSRRTLVNPETDSPTNRHMQ

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.359 kDa

MNASATQATEIWPLVAYFFLVVMLVVGVMALSYIIGERHRSKATDEPFESGIVTVGLARFRLSAKFYLIAVFFVIFDVEAVFLFAWAVAFRELGWPGYIEAIIFISILGAALAYLWRLGALDWGPPRHSAGRFAKDSRSPNHAVVSK

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.487 kDa

MSMSTSTEIIAHHWAFAIFLIIAIGLCCLMLVGGWFLGGRARARSKNTPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.854 kDa

MLAMSDFCTQHPLFSYAVAIVVLLAAMLGLGAVSGTRRVGAARGRSMDLPFESGVLPVGSAHLRIPVQYYLVAMLFVIFDVESVFLFSWAPVAVGAGWRGYGAVVVFVASLAAALAYVWRWGALDWGPVPRRRIDYRRAGDASCAGR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.493 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

147 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.457 kDa

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.171 kDa

MSTTTEILAHHWAFALFLIIAIGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGALDWTPVRSKRQVVKSDIINTTNTHPQ

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.156 kDa

MSTTTEILAHHWAFGLFLIIAVGLCVFMLTGGFLLGGRAKGRAKNVPYESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLYAWAVSIKESGWIGFIEATIFILVLLAGLIYLVRVGALDWTPVRSKRQVVKSDIINTTNNHPQ

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.94 kDa

MCDIYHWGLIAFIVGILFLCVFMLSCGYFLGGCSSSRSKNVPFESGIKSIGNARIQFSVKFYLIAMFFVIFDVEGIYVYAWAISVRDVGWIGFSEIFIFIFILLVSLIYLIRIGMFDWIEQSSRHVHCVDFFDIDTSRYLKKSNKR

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.313 kDa

MDQTLTQFGSVFVFLLLGVIFVVGGYLTSRLLRPSRPNPQKNSTYECGEEAIGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKPLGTFALIEVLVFAGILILGLAYAWVKGDLDWVRPTPNIPKMPPMPELPVAKGASQKD

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.332 kDa

MSMSTSTEVVAHHWAFAIFLIVAIGLCCLMLIGGWFLGGRARARHKNTPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRIGALDWTPTRSRRELVNPENSNSNRQQ

nuoA

NADH-quinone oxidoreductase subunit A

146 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.221 kDa

MSTTTEVIAHHWAFAVFFVVAIGLCCLMLMGAFFLGGRARARAKHTPFESGIDSVGTARMRLSAKFYLVAMFFVIFDVEALYLYAWSVSIRESGWVGFIEAAIFILVLLAGLVYLVRIGALDWTPVRSRRQSKPGTIKNATNSHPQ

nuoA

NADH-quinone oxidoreductase subunit A

145 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.044 kDa

MSTTTEVVAHHWAFAVFLIVSIGLCCLMLAGAWFLGGKARGRHTNTPFESGIASVGTAKLRLSAKFYLVAMFFVIFDVEALYLYAWSTAIRESGWVGFVEAAIFILVLLAGLFYLVRIGALDWAPARRQFDVKPTTISHANRQKP

nuoA

NADH-quinone oxidoreductase subunit A

145 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.245 kDa

MSITTEITAHYWAFAVFLLSALGLCVFMLTGGFLLGARARARSKNVPFESGIDPVGTARLRLSAKFYLVAMFFVIFDVETLYLYAWATAIREAGWVGFIEATIFILILLAGLVYLVRIGALDWTPERSRRLRRAGPIGETPRHQE

nuoA

NADH-quinone oxidoreductase subunit A

144 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.205 kDa

MDQTLSNFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNEEKLSTYECGEPAVGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKQLGMFALVEVLIFAGILVLGLVYAWVKGDLDWVRPTPNIPKMPELPKRHSSGRSNG

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.77 kDa

MDQTLSNFGNVFAFLALGVVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALIEALVFAGILVLGLAYAWVKGDLDWVRPTPNIPKMPEMPSGKSGALRG

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.55 kDa

MQETECCGVLSYIVGSVFLCVFMLLCGYFLGGRSYSRFKNVPFESGIKSVGDARARFSVKFYLIAMIFVIFDVEGIYLYIWSVSIQETGWIGFIEVCIFVFILLISLIYATYVGVFNWKNRLNEYSRVDSLYIGRSKFFKNDK

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.855 kDa

MDQTLSGFGNVFVFLALGIVFVAGGYLTARMLRPSRPNPEKNSTYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKQLGEFALFEALVFAGILILGLAYAWVKGDLDWVRPTPNIPKMPELPAGKPDGSRG

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.997 kDa

MDQTLSDFGNVFVFLLLGVVFVAGGYLTARMLRPSRPNPVKNSTYECGEEAVGSSWVKFNIRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALIEALVFAGILILGLVYAWVKGDLDWVRPTPSVPKMPEMPSPRQSAGRD

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.867 kDa

MDQTLSSFGNVFAFLALGIVFVAGGYLTARMLRPSRPNPAKNSTYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKSLGVFALVEVLVFAGILILGLVYAWVKGDLDWVRPEPKVPQMPVMPDRKAEGGRA

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.994 kDa

MDQTLSEFGNVFVFFLLGVVFVAGGYLTARMLRPSRPNPVKTSTYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDWVRPTPSVPKMPEMPASKSSSQRD

nuoA

NADH-quinone oxidoreductase subunit A

143 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

16.002 kDa

MDQTLSGFGTVFVFLVLGIVFVVGGYLTARMLRPSRPNPEKNSTYECGEHAVGSAWVKFNIRFYVVALIFIIFDVEVVFLYPWATVFKQLGAFALVEVLIFVGILVLGLVYAWVKGDLDWVRPTPNIPKMPEMPVRRSGKANG

nuoA

NADH-quinone oxidoreductase subunit A

142 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.975 kDa

MDQTLSDFGTVFVFLLLGIIFVVGGYLTARLLRPSRPNPEKLAIYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILVIGLVYAWVKGDLDWVRPTPNIPKMPVLEEDESQVVS

nuoA

NADH-quinone oxidoreductase subunit A

141 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.606 kDa

MVSEHISTQQVGPDALFSPLGWDLLALALYVALACIIVVSLLLAARFLGHRSRTPLKNLPYECGVEPTGPARPGYPVPFYLTAIFFVVFDVEVAFIASWAVAYDLLGWAGLAQIAFFIITLLVALIYLWRRGALDWGPQRR

nuoA

NADH-quinone oxidoreductase subunit A

139 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.057 kDa

MTDEATALIAQYWATGLFIIAVFALCALMIGAASLLGGRSRGPSKSLPFESGVVGTGSARQRFSVKFYLVAMLFVIFDIEAVFLFAWAVSVREVGWEGFAGAAVFIFILLAGLVYDSRVGALEWAPRKRGRSPDIVTQR

nuoA

NADH-quinone oxidoreductase subunit A

139 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.862 kDa

MSSAGVPHTDLWPLLLYFELVLVVVGTMLALPPFLGERRTRRTPATEQPYESGIVAVGSSQLRFSVRFYLIAIFFVIFDLEAVFIFAWAIAFRESGWPGYIEILIFIGVLVATLVYLWRIGALDWRTPRQRSIEATIHQ

nuoA

NADH-quinone oxidoreductase subunit A

138 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.486 kDa

MDQTLSDFGAVFVFLLLGTVFVVGGYLTARLLRPSRPNPEKLAVYECGEDAVGTSWVKFNIRFYVVALIFIIFDVEVVFLFPWATVFKQLGEFALIEALVFAGILIIGLAYAWVKGDLDWVRPTPNIPSMPQPPQKEK

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.143 kDa

MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRNRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.101 kDa

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKFYLVAMLFVIFDIEALFLYAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.973 kDa

MPDVPSTLSHDWAFAVFLLGVCGLIAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGNARLRLSAKFYLVAMLFVIFDVEALFLFAWAVSVRESGWVGLVGATVFITILFAGLVYESAIGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.085 kDa

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.09 kDa

MPEATGLMAHNWGFAIFLLGVVGLCAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGGARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLFRVGALDWAPEARRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.085 kDa

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.085 kDa

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.085 kDa

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRKRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.143 kDa

MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRNRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

137 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.143 kDa

MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRNRQAKLKQ

nuoA

NADH-quinone oxidoreductase subunit A

136 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.33 kDa

MQPISPDGSLSPWEPGMFSLAVYAVLVAAFVAVQLFVAWWLGERKPGVEKARPYECGIIPTGSARLRYPVPFYLVAIFFLIFDMEGAYILTWAVAFEELGWAGWLQMSFFIGLLLVGLVYVWKKGGLDWRPSYGKK

nuoA

NADH-quinone oxidoreductase subunit A

135 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.503 kDa

MPKSYTELYFPILLQAVIAMGLAAGLLTVSYLLGKKVRNRVKDMPYESGIVPTGDARHRFSVKFYLVGMLFILFDIEAIFLYPWVVVYRDLSRNGSLFGFYEMLTFVILILSGFFYIWKKGALDWGEPTARPGRK

nuoA

NADH-quinone oxidoreductase subunit A

134 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.419 kDa

MLINTEAVNEYLSFFMFIFFSLGLCFFMLCLSWILGGRSSSRYKNTPFESGIVSSGNTNLYFSVKFYLIAMFFVVFDVEALYLYAWSVSIKESGWIGFSEALMFGISLLLGLFYLVRIRALNWSSSVKNNIQLF

nuoA

NADH-quinone oxidoreductase subunit A

134 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.898 kDa

MFADISAQHWAFAIYVIGAIAICLTMIGLAALLGGRAQGRTKNKPFESGVDSVGTARLRFSAKFYLVAMFFVIFDVEALYLFAWSVSVRESGWVGFIEATIFIGLLLIGLVYLWRIGALEWSPRKPQLNNKNTD

nuoA

NADH-quinone oxidoreductase subunit A

134 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.932 kDa

MFADIAVQHWAFAVYVVGAICICLTMIGLAALLGGRAYGRAKNKPFESGVDSVGNARLRFSAKFYLVAMFFVIFDVEALYLFAWSVSVRESGWVGFIEATIFISLLLVGLIYLWRIGALDWAPKKRVLTDKKPD

nuoA

NADH-quinone oxidoreductase subunit A

134 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.731 kDa

MFADIAVQHWAFAIYVIAAICLCLVMIGLAALLGGRAHGRAKNTPFESGVDSVGNARLRFSAKFYLVAMFFVIFDVEALYLFAWSVSVRESGWVGFIEAAIFIGLLLVGLLYLWRIGALDSAPKKRALTDKKPD

nuoA

NADH-quinone oxidoreductase subunit A

132 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

15.109 kDa

MLKSSVIAAQYWAFFTFFFIAVSICVFMLSISWILGGRSSSRYKNTPFESGIVPTNTTNMYCSVKFYLVAIYFVLFDVEALYLYAWSVSIVECGWIGFIEALIFILFLLSGLIYLISSKLLVWKSKNNIHVT

nuoA

NADH-quinone oxidoreductase subunit A

132 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.847 kDa

MADNAHYWVLLVYTFVVIALVAGMIGVSHFLGQRHLKRATIEPFESGIVTVGYARFRLPVQFYLIAMFFVIFDLEAAYLYAWATAVHAAGWTGYLVIAVFILALLAALAYLWRAGALEWGPKPRALAIVRRR

nuoA

NADH-quinone oxidoreductase subunit A

130 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.633 kDa

MLESSVVGIGKWVVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRFYLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDWR

nuoA

NADH-quinone oxidoreductase subunit A

130 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.7 kDa

MADLIFPIAPGAALAIHVALSAGIVAAIIVVATIIREKRAGARPDVPYESGILPGTPPQGPQNAPYFLIAALFVIFDMEAAILFAWAVAARDAGWVGLIEAAIFIGVLLLALIYLWVDGALDWGGPRQRK

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.754 kDa

MQFTEFWPFILYAGMVLVLVALIVGFSYILGQRPRERATDEPFESGVVTVGFARLRFPAKFYLVAVLFVIFDMEAAFIFAWAVAFRETGWIGYGGALAFITILGVALIYEWRVGALDWQPKGRKHKKHR

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.822 kDa

MSDSIFPINPDAALAIHVALSAGIVAAIIVVAALLREKRAGARPDVPYEGGVLPAAPQQGPINAPYFLIAALFVIFDMEVAILFAWAVAARDTGWFGLIEAAVFIGVLLLALVYLWADGALDWHKERKR

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.69 kDa

MGDLTLPINSGAALAIHVALSAGIVAAIIVVAAWLREKRSGARPDVPYEGGVLPAQPQQGPLNAPYFLIAALFVIFDMEAAILFAWAVAARDAGWLGLIEAAVFIGVLLLALVYLWLDGALDWVKGKRR

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.469 kDa

MGDFLFPIDSGAALAIHVALSAGIVAAIIGVAAVLREKRAGARPDTPYEGGVLPAAPPQGPQNAPYFLIAALFVIFDMEAAILFAWAVAAREAGWVGLIEAAIFIGVLLLALVYLWIDGALDWGPGERK

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.775 kDa

MGDLIFPINPGAALAIHVALSAGIVAAIIVVAAWLREKRSGARADVPYEGGVLPAAPQQGPVNAPYFLIAALFVIFDMEAAILFAWAVAARDTGWLGLIEAAVFIGVLLLALVYLWADGALDWHKERRR

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.69 kDa

MGDLTLPINSGAALAIHVALSAGIVAAIIVVAAWLREKRSGARPDVPYEGGVLPAQPQQGPLNAPYFLIAALFVIFDMEAAILFAWAVAARDAGWLGLIEAAVFIGVLLLALVYLWLDGALDWVKGKRR

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.21 kDa

MLTPLQIYFPIGVVLLVAVVLAFTMLGLANVLGPRRPSLVKQTPFECGSEPIGSARERFGVKFYVVALLFIVFDIEAIFLYPWAVLLLPDGQGYPGLGWPGFISMGIFVFTLVAGLVYVWKKGVLDWAD

nuoA

NADH-quinone oxidoreductase subunit A

129 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.182 kDa

MLTPLQIYFPIGVVLLVAVVLAFTMLGLANVLGPRRPSLVKQTPFECGSEPVGSARERFGVKFYVVALLFIVFDIEAIFLYPWAVLLLPDGQGYPGLGWPGFVSMGIFVFTLVAGLVYVWKKGVLDWAD

nuoA

NADH-quinone oxidoreductase subunit A

128 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.975 kDa

MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGAASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVWRRGGLTWD

nuoA

NADH-quinone oxidoreductase subunit A

128 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.975 kDa

MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGAASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVWRRGGLTWD

nuoA

NADH-quinone oxidoreductase subunit A

128 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.975 kDa

MNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGAASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVWRRGGLTWD

nuoA

NADH-quinone oxidoreductase subunit A

128 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.552 kDa

MTAEISAQYWAFAIFIISAIILCVLILTLSFLLGERKHIKVYSRDLPFESGINPVGNPKLHLSAKFYLIAIFFVLFDIEAFYLYAWSSVIREAGWLGFYEAIIFVSVLLSGLVYLVRIGALKWTPNHS

nuoA

NADH-quinone oxidoreductase subunit A

128 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.909 kDa

MLTPLQTYFPIAVALLVAVGLAAVMLALANVLGPRRPSEVKSTPFECGSLPVSPARERFSVKFYVVALLFIVFDIEAIFLYPWAVLLLPSDGYPGLGWAGYISMGIFVATLVAGLVYVWKKGVLDWAD

nuoA

NADH-quinone oxidoreductase subunit A

126 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.783 kDa

MLKNTLDMTEYLSFLYFIFFSLFFCCFMLFTSWFLGGRSLSRYKNTPFESGVVSVGNTHLHFSVKFYLIAIFFVIFDVEALYLYAWSVSIVESGWIGFVEATIFILFLLLSLFYLVRIKALNWVTS

nuoA

NADH-quinone oxidoreductase subunit A

126 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.552 kDa

MNNKYAEYLPIAIQLMVTLGFISVTLLSSWLLGPKVKSKKKLDAFESGLDPVGNARVQFSIKYFLVATLFVLFDVEVIFFYPWAVNFNYFAEAVNKWEGFVKMLLFMTSLLIGFIYVIKKKALDWE

nuoA

NADH-quinone oxidoreductase subunit A

126 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.236 kDa

MQDALTHGMLREYLPILVLLAMAIGLGLILIAAAAIIAYRNPDPEKVSAYECGFNAFDDARMKFDVRFYLVSILFIIFDLEVAFLFPWAVAFGDMSMTAFWSMMVFLSVLTVGFAYEWKKGALEWA

nuoA

NADH-quinone oxidoreductase subunit A

124 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.415 kDa

MLQNSELLQEYLPIAIFFGIATLVSSLIMILPNLLATKKYNKDKLEPYECGFEPFDDARSKFDIRFYLVAILFIIFDLEITFLVPWAISLGTIGKIGFFSMMFFLFVLTIGFVYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.586 kDa

MTPTPLTPYLPLAVVLLLAGGMAMLIPQITTRLGPRRPSAIKATSFEAGSESSGPARQRFAVKFYVVALLFIVFDVEAVFLYPWAVNFQALGWFGYVEMLVFAVTLVVGLIYIWKKGALDWES

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.999 kDa

MRIALNLAAYFPVLMFLLVGTGLGVALVSIGKILGPNRPDTEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFISMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.242 kDa

MLQNSELLQEYLPIAIFFGIAVLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDICFYLVAILFIIFDLEIAFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWKKGALDW

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.309 kDa

MLQNSELLQEYLPIAIFFGIALLVSGLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIRFYLVAILFIIFDLEIAFLVPWAISLNMIGKIGFFSMIFFLFVLTIGFIYEWKKGALDW

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.342 kDa

MLQNSELLQEYLPIAIFFGIAVLLSVLIMILPNLLSTKKYNKDKLEPYECGFEPFSDARSKFDIRFYLVAILFIIFDLEIAFLVPWAISLNTIGKMGFFSMMFFLFVLIIGFIYEWTKGALDW

nuoA

NADH-quinone oxidoreductase subunit A

123 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.267 kDa

MLQNSELLHEYLPIAIFFGIAVLVSGLIMMLPNLLSTKKYNKDKLEPYECGFAPFSDARSKFDIRFYLVAILFIIFDLEITFLVPWAISLNTIGKIGFFSMMFFLFVLIIGFIYEWTKGALDW

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.882 kDa

MLNTMLGNYFPILLFILVGLAIGVLSMLAGWLLAPNKPDAEKLSPYECGFGAFEDARMKFDVRYYLIAILFILFDLEIAFLFPWAVVLKEIGWFGFVAMLVFLGLLVVGFIYEWVKGALEWD

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.017 kDa

MLSEFLKDYLPIIIFLIIALGLSCAFVVVNLILSPKHPDPEKLSAYECGFEPFEDSRMEFDVRFYLVAILFIIFDLEIAFLFPWAISLGNIGGLGFTSMMIFLFILTVGFIYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.024 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDNLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.045 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPSKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDKLGLFALIEMFIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.133 kDa

MENVYENSYMIVGIFLLLGILLPVVALTLGKLLRPHKPSEAKNTTYESGIEPYHDANVRFHARYYIFALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVAMLLIGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.038 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.024 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDNLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.025 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDDLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.01 kDa

MASVYENSYMIVLIFLLLGILLPVVALTLGKMLRPNKPSAAKATTYESGIEPFHDANIRFHARYYIFALLFVIFDVETLFLYPWAVAYDKLGLFALIEMLIFVVMLLVGLAYAWKKKVLQWL

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.143 kDa

MSNIYANSYLIIFVFLCLGVLLPIGALTAGRWLRPHVPSDAKATTYESGNNPFHDSRVQFQVRYYLFALLFVIFDIETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRWM

nuoA

NADH-quinone oxidoreductase subunit A

122 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.189 kDa

MSNIYANSYLIVFVFLCLGVLLPIGALTIGRWLRPNVPDEAKATTYESGNIPFHDSRIQFQVRYYLFALLFVIFDVETVFLYPWAVVYDQLGLFALVEMIIFIVLLAIGLIYAWKKKVLRWM

nuoA

NADH-quinone oxidoreductase subunit A

121 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.804 kDa

MQSNQLDYLPIFMQMGLAVGFVVLTIIGSSFLGPKRSSVNKDKNFESGIESIGNARVPFSVKYFLVAILFVLFDVEVIFLYPWAINFQELGMQGMIKMVIFMSLLLVGFFYIIKKKALEWD

nuoA

NADH-quinone oxidoreductase subunit A

120 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.497 kDa

MVLQQYGIIAVFLVGGAATAVAALATNWLLRPKKPPEGDKLAAYECGLKTQGPTWIQFKVSYFLYALVFLLFDVETVFLYPWAVRFQALGLFAFAEMIVFIGILVLGLWYAWKEGALKWL

nuoA

NADH-quinone oxidoreductase subunit A

120 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.056 kDa

MLVLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRFYLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE

nuoA

NADH-quinone oxidoreductase subunit A

120 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

14.056 kDa

MLVLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRFYLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.469 kDa

MNLAAYFPVLLFLVVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFLAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.501 kDa

MNLAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.664 kDa

MNLANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALRDIGWFGYASMVIFLLEFIVGFVYIWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.557 kDa

MNLDQYLPVLLFILVGVGVGILPMVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVSLKEIGALGFWSVMVFLGILVVGFVYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.511 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.513 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.471 kDa

MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALRDIGWPGFSAMMIFLLEFLLGFAYIWKKGGLDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.611 kDa

MTLEAYFPVLIFIIFGVVLGIALMSIGRILGPNKPDPAKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALREIGWPGFIAMGVFLLEFIVGFVYIWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.252 kDa

MNIDQYLPVLLFILVGMGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLLPWAVALRDVGGAGFAAVLIFLTVLVVGFVYEWKKGALDWD

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.566 kDa

MNLENYLPVILFILVGVGVGVAPQVLGFLLGPRRPYAAKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVSLREIGATGFWAMMIFLGILVVGFVYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.385 kDa

MNLDQYLPVLLFILVGIAVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFDDARMKFDVRYYLVAILFILFDLEIAFLFPWAVTLQQVGMAGFVAVLIFLTILVVGFAYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.351 kDa

MNLDQYLPVLLFILVGIGVGVVPLVLGYVLGPNRPDAAKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVALHEVGMTGFVAVIVFLAILVVGFAYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.379 kDa

MNLDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.63 kDa

MNLANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALRDIGWLGYASMVIFLLEFIVGFVYIWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.584 kDa

MNLEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.612 kDa

MNLEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALRDIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

119 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.41 kDa

MSLDQYLPIFLFILVGIGVGVAPQVLGYILGPNLPDSAKNSPYECGFEAFGDARMKFDVRYYLVAILFILFDLEIAFLFPWAVALKDIGALGFWSVMVFLTILVVGFIYEWKKGALDWE

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.267 kDa

MLADYAFIGVFFIGAVIFPLVPLVAAYFLGPKRPTPIKLDTYECGLEAVGDIRVQFKIQYYLYALAFVIFDIEVVFLYPWAVAYGQIGLFALIAMAIFLVILVGGLVYEWKKGALEWV

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.342 kDa

MLANYAFIGVFFIGAIIFPIIPLAAAYFLGPKRPTPIKLDTYECGLEAIGDIRVQFKIQYYLYALAFVIFDIEVVFLYPWAVAYGQLGLFAFIAMAIFLIILIGGLVYEWKKGALEWV

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.693 kDa

MLSPKGAILIFFLTGFFLSIIILVLNYLLSPKSKSLIKRETYECGLETIGPTWVQFKGNYFMYALVFVLFDVETIFLYPWAVRFNVLGLFAFVEMVIFIGILVLGLWYAWKEGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.358 kDa

MLANYALIGIFLVAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHVQFKVQYYLYALAFVIFDIEVIFLYPWAVAFNAVGLYGLIAATIFLLMLFAGLLYEWRKGALEWV

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.634 kDa

MIQDYLIIGIFLIASFIFGMVVLLTASLVRPKKPNKEKLSTYECGVETTGSTWIRFKVSYFMYGLVFLLFDVETVFLLPWAVKFKSLGLFALFEMVIFIGILIIGLWYAWKEGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.844 kDa

MLANYFPILVFLGISLFIAVLALTMGWFFGPRRPDKAKLSPYECGFEAFQDARLPFDVRFYLVAILFIIFDLETAFLFPWAVVLRHIGWFGFWAMMVFLAILVVGFIYEWKRGALEWE

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.455 kDa

MSDNFAAVGIALVVAIAINLIMMLMPKLLAPKKPVPEKLTPYEGGNQTIGRTWLGFKSNYFLYALVFTAFDVETVFLFPWALSFRQLGTFAFIEMFVFIVILLVGFWYAWKEGALEWM

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.417 kDa

MLGTYLPIMLLILVALAFGLGSVVFSSLIGQKKFSKVKMAPYECGCEPIGTARERFPIKFYLIAMLFILFDIEAVFLYPWAVLYKKLGLFGLVEMGLFVVILFVGYIYVWKKGALEWE

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.672 kDa

MLKEYLGISLFLAAGLIIPFLAFAVSRLLQTRKNSLVKGEPYECGMETIGDTWIQFKSNYFLYALVFVAFDVETVFLYPWAVKFQQLGTFAIVEMFIFITILVVGFWYAWKEGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.397 kDa

MLTNYAFIGIFALAAITFPLLPLVLSAFLRPNRPTPVKLSTYECGLEAIGDIWVQFKVQYYLYALAFVIFDIETVFLYPWAVAYGQLGLFALFEMVVFLAILTIGLVYAWKKGALEWI

nuoA

NADH-quinone oxidoreductase subunit A

118 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.5 kDa

MLNHYLPVLIFLLVALVVGVAPLLMGSSLGPHRPDSEKLSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVVFDQIGMTGFLAMMLFLAILVVGFIYEWKKGALEWE

nuoA

NADH-quinone oxidoreductase subunit A

117 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.466 kDa

MSDWIGVALFIVVGIVFGAGGMLTSFLIHPRSKNKFKLETYECGLPTEGATWVRFKTQYFTYALMFVIFDVEVIYLYPWAVSFVDLGLAGLIKMFLFIFILVLGLWYAWKEGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

116 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.089 kDa

MNFTLLVVVLLTAIAFVGVVIALSNAISPRSYNAQKFEAYECGIPTRGKSWMQFRVGYYLFAILFLMFDVETVFLFPWAVIARDLGPQGLISILFFLVVLVLGLAYAWKKGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

116 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.089 kDa

MNFTLLVVVLLTAIAFVGVVIALSNAISPRSYNAQKFEAYECGIPTRGKSWMQFRVGYYLFAILFLMFDVETVFLFPWAVIARDLGPQGLISILFFLVVLVLGLAYAWKKGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

116 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.286 kDa

MNFTFLVVVLLTALAFVGVVIALSRAISPRSYNVQKFEAYECGIPTRGKSWMQFRVGYYLFAILFLMFDVETAFLFPWAVVMHDMGPQGLVSILFFFIILVLGLAYAWRKGALEWK

nuoA

NADH-quinone oxidoreductase subunit A

116 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I subunit 3 family.

13.099 kDa

MYFTLLVVVILTAIALVAVALGIARAISPRSYNSQKGEAYECGIPTRGRSWMQFKVGYYLFAILFLMFDVETVFLFPWAVVVQDLGVYGLFSILFFLVILVLGLAYAWKKGALEWK