About Products Protein Database Contact

Protein expression services for nuoA | NADH-quinone oxidoreductase subunit A

Description
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Family
Belongs to the complex I subunit 3 family.
Species
Psychrobacter sp. (strain PRwf-1)
Length
211 amino acids
Sequence
MTSAFNWSALAFILAAIGLVIFMLVVPRLLGGRSQGTEKEEVFESGVVGAGNARIRLSAKFYLVAIFFVIFDLEALYLYAYSVSVREVGWIGYATALIFVVDLLIGLIYALSLGALNWAPADKRRKKERLSAAPAGFNLASITKFNGIDELHTDPTGKVPAQSSGQVNVSNDIEANKRHLANIDRINVTGNVTSVDFSTQSTNSLSNKSSS
Mass
22.8 kDa
Simulated SDS-PAGE
Western blot of nuoA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make nuoA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here