Description
NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Family
Belongs to the complex I subunit 3 family.
Species
Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Sequence
MDQTLSEFGNVFVFFLLGVVFVAGGYLTARMLRPSRPNPVKTSTYECGEEAVGSAWVKFNIRFYVVALIFIIFDVEVVFLFPWATVFRQLGSFALVEALVFAGILILGLVYAWVKGDLDWVRPTPSVPKMPEMPASKSSSQRD
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service