murR

HTH-type transcriptional regulator MurR

287 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.887 kDa

MLYLAKMRNAEGEFTENEQKIATFLLAHVGELKTVSSRNMAKQLEISQSSIVKFAQKLGANGFTELRMALIEEHSVSREKKRDKAVHLHSSITSEDSLEMMARKLNREKIVALEETYNLMDYERLEQVINLISKAPLIQITGVGGSALVGRDLSFKLMKIGFRVACEVDTHVQATIAQALRQGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLADYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGMVQLNDVESLRMIERSSELITLLDRS

murR

HTH-type transcriptional regulator MurR

287 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.817 kDa

MLYLAKMRNAEGELTENEQKIASFLLAHVSELKTVSSRNLAKQLEVSQSSIVKFAQKLGAKGFTELRMALIEEYSVNREKKHDTALHLHSTITSEDSLEVIARKLNREKMFALEETCSLMDFDRLKQVINLISKARLIQITGVGGSALVGRDLSFKLMKIGYRVACEVDTHVQATIAQALQEGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLADYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGMVQLNDVESLRMIERSSELINLLGRS

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.196 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.212 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCSLFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.327 kDa

MLYLTKIRNAESEFTENEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATAQHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGCDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.327 kDa

MLYLTKIRNAESEFTENEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATAQHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGCDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.327 kDa

MLYLTKIRNAESEFTENEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATAQHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGCDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.413 kDa

MLYLTKIRNAESEFTGNEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKEQALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVTCEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEVARKQGATVIAITSLTDSPLRRLAHYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIERSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.196 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.283 kDa

MLYLTKISNAGSEFTENEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIDVISKAQFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.283 kDa

MLYLTKISNAGSEFTENEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIDVISKAQFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.192 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.192 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.293 kDa

MLYLTKIRNAESEFTGNEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.395 kDa

MLYLTKIRNAESEFTENEQKIADFLRANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNAMALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator. Also represses its own transcription.

31.192 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.281 kDa

MLYLTKIRNAESEFTGNEQKIADFLRANVSELKSVSSRKMAKLLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEAISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIERSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.196 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.355 kDa

MLYLTKIRNAESEFTGNEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKEQALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIERSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.29 kDa

MLYLTKIRNAESEFTGNEQKIADFLQAKVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEILLCAEAARKQGATVIAITSLTDSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIERSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.168 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNTTALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVASLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.196 kDa

MLYLTKISNAGSEFTENEQKIADFLQANVSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNTTALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCVEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVASLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.37 kDa

MLYLTKIRNAESEFTGNEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVTCEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSPLRRLAHYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIERSSELTQRLK

murR

HTH-type transcriptional regulator MurR

285 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

31.425 kDa

MLYLTKIRNAESEFTENEQKIADFLRANVSELKSVSSRKMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVAYEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK

murR

HTH-type transcriptional regulator MurR

266 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

29.129 kDa

MLYLTKIRNAESEFTGNEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQHQ

murR

HTH-type transcriptional regulator MurR

266 amino acids

Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.

29.133 kDa

MLYLTKIRNAESEFTGNEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHVHSSITSDDSLEVIARKLNREKEMALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQHQ