Description
Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.
Sequence
MLYLTKIRNAESEFTGNEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHVHSSITSDDSLEVIARKLNREKEMALEQTCALFDYARLQKIIEVISKAPFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQHQ
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service