About Products Protein Database Contact

Protein expression services for murR | HTH-type transcriptional regulator MurR

Description
Represses the expression of the murPQ operon involved in the uptake and degradation of N-acetylmuramic acid (MurNAc). Binds to two adjacent inverted repeats within the operator region. MurNAc 6-phosphate, the substrate of MurQ, is the specific inducer that weakens binding of MurR to the operator.
Species
Escherichia coli (strain B / REL606)
Length
285 amino acids
Sequence
MLYLTKISNAGSEFTENEQKIADFLRARVSELKSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELRMALIGEYSASREKTNATALHLHSSITSDDSLEVIARKLNREKELALEQTCALFDYARLQKIIDVISKAQFIQITGLGGSALVGRDLSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLADSPLRRLAHFTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGLVQLNDVESLKMIQRSSELTQRLK
Mass
31.3 kDa
Simulated SDS-PAGE
Western blot of murR recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make murR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here