KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

398 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.729 kDa

MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVMVLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYSQQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMDVSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRMGNTMPLEKTGVTQRYRTDAVHVAWRA

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

398 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.729 kDa

MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVMVLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYSQQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMDVSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRMGNTMPLEKTGVTQRYRTDAVHVAWRA

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

398 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.729 kDa

MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVMVLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYSQQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMDVSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRMGNTMPLEKTGVTQRYRTDAVHVAWRA

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

398 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.729 kDa

MLVLLIVFFNSYYTHCSHHSLYSFHCTPPDPAMKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVMVLSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMGTPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYSQQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMDVSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMAHVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRMGNTMPLEKTGVTQRYRTDAVHVAWRA

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

386 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

42.748 kDa

MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFKGNKKNKILFDKTTGEQKVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQVHATDNRFCIDNGVMIAQAGLLEYRMGGIVKDFSETVVTQKFRTDEVYAAWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

385 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.079 kDa

MVNLNGIPPRGKRNYYLAIGLEGSANKLGVGIIKHPVLEKHEDSDLSYECDVEILANIRDTYVTPPGEGFLPRDTARHHRNWVVRIIRKALTEAKIDDPTKIDVICFTRGPGMGAPLHCVVIAARTLSLMWDIPLVGVNHCVGHIEMGREITGAKNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNAPSPGYNIEQLAKQCKNKEKLVVLPYTVKGMDLSMSGILQYIDTLAKDLFKKNLKNKLLFDSRTGEQLVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRSNGQVHATDDRFCIDNGVMIAQAGLLEYRTGHFVKDLSETIVTQKFRTDEVYIAWRE

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

385 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.079 kDa

MVNLNGIPPRGKRNYYLAIGLEGSANKLGVGIIKHPVLEKHEDSDLSYECDVEILANIRDTYVTPPGEGFLPRDTARHHRNWVVRIIRKALTEAKIDDPTKIDVICFTRGPGMGAPLHCVVIAARTLSLMWDIPLVGVNHCVGHIEMGREITGAKNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNAPSPGYNIEQLAKQCKNKEKLVVLPYTVKGMDLSMSGILQYIDTLAKDLFKKNLKNKLLFDSRTGEQLVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRSNGQVHATDDRFCIDNGVMIAQAGLLEYRTGHFVKDLSETIVTQKFRTDEVYIAWRE

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

385 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

43.035 kDa

MVNLNKVQPRSGGDHYLALGIEGSANKLGVGILKHPMLSQHKQGSLSHDCQAEILSNIRDTYITPPGEGFLPRDTARHHRNWVVRLVRRALVEAGIEDPRLLDVICFTKGPGMGAPLHSVVVAARTMSMLWDVPLVAVNHCIGHIEMGREITKAENPVVLYVSGGNTQVIAYSENRYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQLAKQCKNKDRLVELPYTVKGMDLSMSGILAHIDSLAKDLFRRNTKNYKLFDRETGKQLVTVEDLCYSLQEHLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQQMMASMCQSRADGQVHATDERFCIDNGVMIAQAGLLQYRMGDIVKDFSETVVTQRFRTDEVYVSWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

373 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.432 kDa

MVDLNGISPKNKGYYVALGLEGSANKLGVGVIKQFVDGSPTEIVSNIRDTYITPPGEGFLPRDTARHHKNWCVRLVKRALAEAGVTPGQLDAICFTKGPGMGAPLHSVVIVARTVSLLWDVPLVPVNHCIGHIEMGREITGAQNPVVLYVSGGNTQVIAYSNQKYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQMALKCKNKERLVELPYTVKGMDLSLSGILAYIDSLAKDLFRKNYSNKLLFDKKTHEQLVTVEDLCYALQETLFSMLVEITERAMAHVNSAHVLIVGGVGCNLRLQEMMEQMCMDRANGHVYATDERFCIDNGVMIAQAGLLQYRMGDYVKDFKETVVTQKFRTDEVLVSWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

373 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.441 kDa

MTVDLDQYAKPGKDYYLALGLEGSANKLGVGVIKHNLGQLSLDNRAEILSNVRDTYVTPPGEGFLPRDTARHHRNWAVRIIKKALIEAKVKGSDLDCICFTQGPGMGAPLQSVVIAARTLSQLWDLPLVGVNHCVGHIEMGREITGADNPVVLYVSGGNTQVIAYSRQRYRIFGETLDIAIGNCLDRFARTLRIPNEPAPGYNIEQMAKKGKHLVPLPYTVKGMDLSMSGILAHVDSLAKDLFAENKNKKLIDDETGEQITSEDLCFSLQETLFSMLVEITERAMAHVQSNQVLIVGGVGSNERLQQMMELMVNDRKNGSIFATDERFCIDNGIMIAHAGLLGYRMGQTNELWNTVCTQRFRTDEVFVKWRDD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

373 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.432 kDa

MVDLNGISPKNKGYYVALGLEGSANKLGVGVIKQFVDGSPTEIVSNIRDTYITPPGEGFLPRDTARHHKNWCVRLVKRALAEAGVTPGQLDAICFTKGPGMGAPLHSVVIVARTVSLLWDVPLVPVNHCIGHIEMGREITGAQNPVVLYVSGGNTQVIAYSNQKYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQMALKCKNKERLVELPYTVKGMDLSLSGILAYIDSLAKDLFRKNYSNKLLFDKKTHEQLVTVEDLCYALQETLFSMLVEITERAMAHVNSAHVLIVGGVGCNLRLQEMMEQMCMDRANGHVYATDERFCIDNGVMIAQAGLLQYRMGDYVKDFKETVVTQKFRTDEVLVSWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

373 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.441 kDa

MTVDLDQYAKPGKDYYLALGLEGSANKLGVGVIKHNLGQLSLDNRAEILSNVRDTYVTPPGEGFLPRDTARHHRNWAVRIIKKALIEAKVKGSDLDCICFTQGPGMGAPLQSVVIAARTLSQLWDLPLVGVNHCVGHIEMGREITGADNPVVLYVSGGNTQVIAYSRQRYRIFGETLDIAIGNCLDRFARTLRIPNEPAPGYNIEQMAKKGKHLVPLPYTVKGMDLSMSGILAHVDSLAKDLFAENKNKKLIDDETGEQITSEDLCFSLQETLFSMLVEITERAMAHVQSNQVLIVGGVGSNERLQQMMELMVNDRKNGSIFATDERFCIDNGIMIAHAGLLGYRMGQTNELWNTVCTQRFRTDEVFVKWRDD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

372 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.103 kDa

MVVDLDKYLKPGKDHYLALGLEGSANKLGVGVIKHNKGPLSSTNRAEVLSNIRDTYITPPGEGFLPRDTARHHRNWVVRIIKQALATAKIAGKDIDVICFTQGPGMGAPLQSVVIAARTLAQLWNIPIVGVNHCVGHIEMGREITGAENPVVLYVSGGNTQVIAYSKQRYRIFGETLDIAIGNCLDRFARTLKIPNEPAPGYNIEQMAKKGKHLVPLPYTVKGMDLSMSGILAAIDSIAKEMFGKQQKKLIDEESGEPITAEDLCFSLQETLFSMLVEITERALAHVDSNQVLIVGGVGSNQRLQEMMKLMIQDRKNGQIYATDERFCIDNGIMIAHAGLLSYRTGQTNQLNNTVCTQRFRTDEVFVKWRDD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

372 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

41.103 kDa

MVVDLDKYLKPGKDHYLALGLEGSANKLGVGVIKHNKGPLSSTNRAEVLSNIRDTYITPPGEGFLPRDTARHHRNWVVRIIKQALATAKIAGKDIDVICFTQGPGMGAPLQSVVIAARTLAQLWNIPIVGVNHCVGHIEMGREITGAENPVVLYVSGGNTQVIAYSKQRYRIFGETLDIAIGNCLDRFARTLKIPNEPAPGYNIEQMAKKGKHLVPLPYTVKGMDLSMSGILAAIDSIAKEMFGKQQKKLIDEESGEPITAEDLCFSLQETLFSMLVEITERALAHVDSNQVLIVGGVGSNQRLQEMMKLMIQDRKNGQIYATDERFCIDNGIMIAHAGLLSYRTGQTNQLNNTVCTQRFRTDEVFVKWRDD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

371 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

40.282 kDa

MIAIGLEGSANKLGVGIILHPDNGGEPRVLANIRHTYVSPPGEGFLPKDTAKHHRKWVVSLVKAALKEAEIGVSDVDCICYTKGPGMGPPLQSVALAARTLSLLWGKQLVGVNHCVGHIEMGRYITGAQNPIVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKRLVELPYTVKGMDCSFSGILAAIDALAAAYGLSGDQQAKENIGLTEDALKLKVDSVDKYNNEGGIPTREDLCFSLQETVFSMLVEITERAMAHVGSREVLIVGGVGCNERLQEMMGIMARDRGGNVFATDERFCIDNGIMIAQAGILAYKTGFTTKLEDSTCTQRFRTDEVFVQWRDD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

371 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

40.282 kDa

MIAIGLEGSANKLGVGIILHPDNGGEPRVLANIRHTYVSPPGEGFLPKDTAKHHRKWVVSLVKAALKEAEIGVSDVDCICYTKGPGMGPPLQSVALAARTLSLLWGKQLVGVNHCVGHIEMGRYITGAQNPIVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKRLVELPYTVKGMDCSFSGILAAIDALAAAYGLSGDQQAKENIGLTEDALKLKVDSVDKYNNEGGIPTREDLCFSLQETVFSMLVEITERAMAHVGSREVLIVGGVGCNERLQEMMGIMARDRGGNVFATDERFCIDNGIMIAQAGILAYKTGFTTKLEDSTCTQRFRTDEVFVQWRDD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

364 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

39.441 kDa

MIAIGLEGSANKLGVGIMLHPEDGSTPQVLANIRHTYVSPPGEGFLPKDTARHHRAWVVKLVKRALREARVSVDDVDCICFTKGPGMGAPLQSVAVAARTLSLLWGKELVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSFSGILAAIDGLAASYGLNGKEKEEEEKLVALSDPATSEAVENVKPTRADLCFSLQETIFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGMLAYKTGFRTPLTESTCTQRFRTDGVFVKWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

363 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

39.315 kDa

MIAIGLEGSANKLGVGIMLHPKDGSTPQVLANIRHTYVSPPGEGFLPKDTARHHRSWVVSLVKKALKEARISVDDVDCICYTKGPGMGAPLQSVAVAARTLSLLWGKELVGVNHCVGHIEMGRLITGASNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSMSGILAAIDALAATYGLNGEQPDEEEDVTDVTPVSDGALESRKPTRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGMLAYKTGFRTPLKESTCTQRFRTDDVFVQWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

363 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

38.595 kDa

MVSVDTPSSLGKPRGDPRQLYRVGGWDEEIYVLGIESTAHTFGVGIASTKPPYILVSVRDTYHPPKGGIHPREAASHHARVASEVILDALRTVGLSIRDIDAVAVALGPGLGPALRVGATIARGLAAYYGKPLVPVNHAVAHIEIARLYTGLGDPVVLYVSGGNTVVAAYAKARYRVFGETLDIALGNLLDTFARDAGIAPPYIVSGLHIVDRCAEAASKPADLPYVVKGMDVSFSGLLTAALRLWTKAGSEDEKAAVCLGLREVAYGSVVEVTERALAHTRKKSVMLTGGVAASPILRNKVRSMASYHGAVADWPPPQLAGDNGAMIAWTGLLNYLAGITVDVEESVVKQRWRLDVVEIPWR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

363 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

39.315 kDa

MIAIGLEGSANKLGVGIMLHPKDGSTPQVLANIRHTYVSPPGEGFLPKDTARHHRSWVVSLVKKALKEARISVDDVDCICYTKGPGMGAPLQSVAVAARTLSLLWGKELVGVNHCVGHIEMGRLITGASNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSMSGILAAIDALAATYGLNGEQPDEEEDVTDVTPVSDGALESRKPTRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGMLAYKTGFRTPLKESTCTQRFRTDDVFVQWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

363 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

38.595 kDa

MVSVDTPSSLGKPRGDPRQLYRVGGWDEEIYVLGIESTAHTFGVGIASTKPPYILVSVRDTYHPPKGGIHPREAASHHARVASEVILDALRTVGLSIRDIDAVAVALGPGLGPALRVGATIARGLAAYYGKPLVPVNHAVAHIEIARLYTGLGDPVVLYVSGGNTVVAAYAKARYRVFGETLDIALGNLLDTFARDAGIAPPYIVSGLHIVDRCAEAASKPADLPYVVKGMDVSFSGLLTAALRLWTKAGSEDEKAAVCLGLREVAYGSVVEVTERALAHTRKKSVMLTGGVAASPILRNKVRSMASYHGAVADWPPPQLAGDNGAMIAWTGLLNYLAGITVDVEESVVKQRWRLDVVEIPWR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

361 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.962 kDa

MLAIGLEGSANKLGVGIMLHPDDGSSPQVLANVRHTYVSPPGEGFLPKDTARHHRAWVVRLVKRTLREARISPDDVDCICFTQGPGMGAPLQSVAVAARMLSLLWKKPLVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVELPYTVKGMDCSFSGMLAAIDALAASYGLDGPQSDEAVDANSPAAVEAGENGKPTRADLCFSLQETIFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYKTGFRTPLKESACTQRFRTDAVFVKWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

361 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.962 kDa

MLAIGLEGSANKLGVGIMLHPDDGSSPQVLANVRHTYVSPPGEGFLPKDTARHHRAWVVRLVKRTLREARISPDDVDCICFTQGPGMGAPLQSVAVAARMLSLLWKKPLVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVELPYTVKGMDCSFSGMLAAIDALAASYGLDGPQSDEAVDANSPAAVEAGENGKPTRADLCFSLQETIFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYKTGFRTPLKESACTQRFRTDAVFVKWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

358 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.591 kDa

MIAIGLEGSANKLGVGIMLHPDNGNPPQVLANIRHTYVSPPGEGFLPKDTARHHRAWVVKLVKKALKEAHVSVQDVDCICFTKGPGMGAPLQSVAVAARMLSLLWGKELVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSFSGILAAVDGLATTYGLGGEGKDDETDTPIPDADGNGKPTRADLCFSLQETIFSMLVETTERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYSTGFRTPLKDSTCTQRFRTDDVFVKWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

356 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.296 kDa

MGLDITQKKRRIALGCEGSANKLGIGVILHEGDTSTVLSNVRHTFVSPAGTGFLPKDTAQHHRAFFVRVAKQALSDAGIRIADIDCICYTRGPGMGGPLASVAVAARTLALLWGKELVGVNHCVGHIEMGRTITGADHPVVLYVSGGNTQVIAYAEQRYRIFGETLDIAVGNCLDRFARALNISNDPAPGYNIEVLARKGGRVLLDLPYAVKGMDCSFSGILTRAEELAAQMKANEGKGTDGEPFTGADLCFSLQETVFAMLVEITERAMAHVGSNQVLIVGGVGCNERLQEMMGLMAADRGGSVYATDERFCIDNGIMIAHAGLLAYETGFRTPIEESTCTQRFRTDEVLVKWRK

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

356 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.296 kDa

MGLDITQKKRRIALGCEGSANKLGIGVILHEGDTSTVLSNVRHTFVSPAGTGFLPKDTAQHHRAFFVRVAKQALSDAGIRIADIDCICYTRGPGMGGPLASVAVAARTLALLWGKELVGVNHCVGHIEMGRTITGADHPVVLYVSGGNTQVIAYAEQRYRIFGETLDIAVGNCLDRFARALNISNDPAPGYNIEVLARKGGRVLLDLPYAVKGMDCSFSGILTRAEELAAQMKANEGKGTDGEPFTGADLCFSLQETVFAMLVEITERAMAHVGSNQVLIVGGVGCNERLQEMMGLMAADRGGSVYATDERFCIDNGIMIAHAGLLAYETGFRTPIEESTCTQRFRTDEVLVKWRK

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

356 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

39.201 kDa

MTTYLSLGLEGSANKLGVGVIKHTVTDANAENGFSTDILSNIRDTYITPPGEGFLPRDTARHHRNWVVRIIKRALDEAKISDPTKLHCISFTQGPGMGAPLQSVVIAARTIAQMWGVPLVGVNHCVGHIEMGRTITGATNPVVLYVSGGNTQVIAYSKQRYRIFGETLDIAVGNCLDRFARVLKIPNAPSPGYNIEQLAKKGKKYVPLPYTVKGMDLSMSGVLQFVESLAKRFQAGDLVVDGHQVTAEDLCFSLQETLFAMLVEITERAMAHVNSQQVLIVGGVGCNERLQEMMGIMARDRNGSVYATDERFCIDNGIMIAHAGLLAWRQGFETKMEKTQCTQRFRTDEVLVDWRV

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

352 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.273 kDa

MIAIGLEGSANKLGVGIMLHPEDGSTPRVLANIRHTYVSPPGEGFLPKDTARHHRSWVVKLVKRALREARISVRDVDCICFTKGPGMGAPLQSVAVAARMLSLLWGKELVGVNHCVGHIEMGRLITGSTNPVVLYVSGGNTQVIAYSSQRYRIFGETLDIAVGNCLDRFARTLHISNDPAPGYNIEQLAKKGKQLVDLPYTVKGMDCSFSGILAAIDGLAASYGLNGEEKEEEGAGDDSKPTRADLCFSLQETVFSMLVEITERAMAHVGSKEVLIVGGVGCNERLQEMMGIMARDRGGSVHATDERFCIDNGIMIAQAGLLAYKTGFRTPLKESTCTQRFRTDDVFVKWRD

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

352 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

38.26 kDa

MIAIGLEGSANKIGIGVISHPGPNKTPIILSNLRHTYISPPGEGFLPKDTAIHHRAWVVRLIKQAVQQAGVKIEDIECICYTKGPGMGAPLQSVALAARTISLLWGKPVVGVNHCVGHIEMGRAITKADNPVVLYVSGGNTQVIAYSAQRYRIFGETLDIAIGNCIDRFARTLMIPNNPFPGYNVEQLAKKGKNLVDLPYGVKGMDASFSGILAAADLLAKGLDESLPLEKRLKTEEGELVTREDLCFSLQETIYAMLVEITERAMAHVGSQQVLVVGGVGSNERLQQMMGMMARDRGGSVFATDERFCIDNGIMIAHAGLLEYCTGVVTKMEDTTCTQRFRTDEVFVGWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

349 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.829 kDa

MPPKRDGEVLVLGIESTAHTFGVGIVSTRPPIVRADVRRRWTPREGGILPREVAEFFSLHAGEAVAEALGEAGVSIADVDAVAVALGPGMGPALRVGATVARALSAKYGKPLVPVNHAVAHVEAARFTTGLRDPVALYVAGGNTTVVSFVAGRYRTFGETLDIALGNLLDTFAREAGIAPPYVAGGLHAVDRCAEGGGFVEGIPYVVKGQDVSFSGILTAALRLLKRGARLSDVCYTLREVAFSSVVEVTERCLAHTGKRQATLTGGVAANRVLNEKMSLMAGLHGAVYRPVDVRLSGDNGVMIALTGLAAYLHGVIIDPGEAYIRQRWRIDEVDIPWYPWLPGDPPPG

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

346 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

37.421 kDa

MAFTNKSSYIALGCEGSANKLGIGVILHTPTETKILSNLRDTFVSPPGTGFLPKDTAAHHRAHFVRLAREALAEAKITPADVDCICYTKGPGMGAPLNSVAVAARALSLLWDRPLVGVNHCVGHIEMGRYITGAENPVVLYVSGGNSQVIAYAEQRYRIFGETLDIAVGNCLDRFARTLEISNDPAPGYNIEQLAKKGSKLLDIPYAVKGMDCSFSGILASADALAAQMKAGADFTPEDLCFSLQETVFAMLVEITERAMAHVGSSQVLIVGGVGCNERLQEMMGHMARERGGSVYATDERFCIDNGIMIAHAGLLAYETGFRTSLEESTCTQRFRTDEVFIKWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

346 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

37.057 kDa

MICVGIESTAEKLGVGVVTDDGEILVNVKAQYIPPPGSGILPREAAEHHSRELPELLERALKNAGVEPEDIDLVAYSQGPGLGPCLRVGATAARTLALTLEVPLAPVNHCVAHVEIGKLAARQDGFDFDEPVTLYVSGGNTQVLALKAGRYRVFGETLDLPVGNMLDTFARKVGLPHPGGPEIERLAEEGEPVELPYTVRGTDVSFSGLLTAALRRYEQGDRLEDVCAGLQETAFAMLVEITERAAAQLGRDEILLTGGVAANRRLSEMMHEMAEDRGAEAYTVPPELAGDNGAMIAWTGILVHEHGLSIPPDEIPEKAIVKQRYRVDEAPVPWAARPSRSADSQG

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

346 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

37.421 kDa

MAFTNKSSYIALGCEGSANKLGIGVILHTPTETKILSNLRDTFVSPPGTGFLPKDTAAHHRAHFVRLAREALAEAKITPADVDCICYTKGPGMGAPLNSVAVAARALSLLWDRPLVGVNHCVGHIEMGRYITGAENPVVLYVSGGNSQVIAYAEQRYRIFGETLDIAVGNCLDRFARTLEISNDPAPGYNIEQLAKKGSKLLDIPYAVKGMDCSFSGILASADALAAQMKAGADFTPEDLCFSLQETVFAMLVEITERAMAHVGSSQVLIVGGVGCNERLQEMMGHMARERGGSVYATDERFCIDNGIMIAHAGLLAYETGFRTSLEESTCTQRFRTDEVFIKWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

346 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

37.057 kDa

MICVGIESTAEKLGVGVVTDDGEILVNVKAQYIPPPGSGILPREAAEHHSRELPELLERALKNAGVEPEDIDLVAYSQGPGLGPCLRVGATAARTLALTLEVPLAPVNHCVAHVEIGKLAARQDGFDFDEPVTLYVSGGNTQVLALKAGRYRVFGETLDLPVGNMLDTFARKVGLPHPGGPEIERLAEEGEPVELPYTVRGTDVSFSGLLTAALRRYEQGDRLEDVCAGLQETAFAMLVEITERAAAQLGRDEILLTGGVAANRRLSEMMHEMAEDRGAEAYTVPPELAGDNGAMIAWTGILVHEHGLSIPPDEIPEKAIVKQRYRVDEAPVPWAARPSRSADSQG

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

343 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

37.019 kDa

MLVLGVESTAHTFSLGLVLDGKILGQLGKTYLPPSGEGIHPREAADHHSKVAPVIFRQLLNAHGITASDIDVIAYAAGPGLGPALRIGAVFARALAIKLGVPLVPVHHGIAHIEVARYTTASCDPLVLLISGGHTLIAGFSEGRYRIFGETLDVAIGNAIDMFAREVGLGFPGVPAVEKCAESADRLVPFPMTIIGQDLSYAGLTTYALKLWKSGTPLPVVCKSLVEAAYYMLAEVTERALAFTKKRELVVAGGVARSKRLRGILEHVGREYGVAVKIVPDEYAGDNGAMIALTGYYAYRRGIRTTPEESFVKQRWRLDSVDIPWFYDLCEEVVLNTSTKRRP

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

339 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.609 kDa

MWFYSVPEVIIGVESTAHTFSLGLVSGGRVLGQVGKTYVPPAGRGIHPREAAEHHAKAAPQLFRKLIEEFNVSLGDVEAVAYSAGPGLGPALRVGAVFARALAIKLGVPLVPVHHGVAHVEIARYATGSCDPLVLLISGGHTVVAGFSDGRYRVFGETLDVAIGNAIDMFAREVGLGFPGVPAVEKCAEAAEELVAFPMPIVGQDLSYAGLTTYALQLVKRGIPLPVVCRSLVETAYYMLAEVTERALAFTKKRELVVAGGVARSRRLREILYEVGREHGAEVKFVPDEYAGDNGAMIALTGYYAYRRGIAVEPGESFVRQRWRLDTVDVPWFYDLCNR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

338 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.924 kDa

MGIESTSHTFGVGIVKYVSSINETRILANTYDKYIPEKGGIHPREAALHHARVAAKVLSDALQKANISMRDVSAIAVALGPGLGPCLRVGASLARFLSSYYNIPLIPVNHAVAHIEIGKFLFGFKDPLIIYVSGGNTLIAIQRKKRYRILGETLDIPIGNLLDTFAREIGLAPPYIVNGKHQVDICAEWGSEFISLPYTVKGSDLSFSGLLTAALSLAEKYIDNKKKLGNVCLSLRETAFNMLVEVAERSLVLAGKKEVLLVGGVASNKVLRKKLELMASLHGAKYAGTPPEYSGDNGAMIAYTGLLGYLHNVIVEPRKAFVRQRWRLDEVELPWIQD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

336 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.707 kDa

MNVLGIESTAHTFGVGIVSDDDSEIRILSNERDTFVPKQGGMKPSDLGRHHSEVAPEVLQKALIKANLSIRDINYIAVSLGPGIGPALRVGATIARALSLKYDIKLVPVNHGIAHIEIGRFTTRSKDPLILYLSGGNTIITTYLDGKYRIFGETLDIALGNMLDTFVREVGLAPPYIVNGVHQIDLCANKGGNFIELPYIVKGQDMSYSGLLTAALRATKNNRLEDVCYSVREVAFDMLLEATERALALTGKKEILVVGGVAASVSLKTKLYNLAKDWNVEVKIVPPEYSGDNGAMIAFTGLLEARHGVTIPVEKSIIRPRWRVDQVDVTWRLSEN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

336 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.3 kDa

MLFGMRALKVLGIESTAHTFGVGIATSSGDILVNVNHTYVPRHGGIKPTEAAEHHSRVAPKVLSEALQKAGISVEEVDAVAVALGPGMGPCLRVGATLARYLALKFGKPLVPVNHAIAHLEISRLTTGLEDPVFVYVAGGNTMVTTFNEGRYRVFGETLDIPLGNCLDTFAREVGLGFPGVPRVEELALKGREYIPLPYTVKGQDVSYSGLLTHALSLYRSGRARLEDVCYSLVETAYSMLVEVAERALAHTGKSQLVLTGGVARSRILLEKLRRMVEDRGGVLGVVPPEYAGDNGAMIAYTGALAFSHGVRVPVEESRIQPYWRVDEVVIPWRSR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

336 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.547 kDa

MLVLGVESTAHTFSIGVVKDGVVLGQLGKTYIPPGGGGIHPREAAEHHARVAPSILRQLLGQLGVGLSDIGAVAYAAGPGLGPALRVGAVLARALAIRLGVPVVPVHHGVAHIEVARYATGACDPLVVLISGGHTVVAGYSDGRYRVFGETLDVAIGNAIDMFAREVGLGFPGVPAVEKCAESAETVVPFPMPIVGQDLSYAGLATHALQLVKRGVPLPVVCRSLVETAYYMLAEVVERALAYTRKREVVVAGGVARSRRLKEILRAVGEEHGAVVKVVPDEYAGDNGAMIALTGYYAYRRGVYTTPEGSFVRQRWRLDSVDVPWFRDLCPVTTYI

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.222 kDa

MTTVLGIEGTAWNLSAAIVDEDDVIAEVTETYRPKTGGIHPREAAQHHALHASDVIERLLKEYRDKGHSPENIDAIAFSQGPGLGACLRTVATSARALALSLDIPLVGVNHCIGHVEIGRWKTPAVDPVVLYVSGGNSQVLAHRAGKYRIFGETLDIGIGNALDKFARGAGLTHPGGPKVEEYARKATNYVKMPYVVKGMDFSFSGLSTAATDALKDNSLEDVCYSFQENAFAMLVEVTERALAHTGKSEVLLAGGVGANMRLREMLDLMCEDRGASFYVPERRFMGDNGAMIAYTGLLMFNSGTTLPIENSHVDPSFRPDTVDVTWIADEKEVL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

335 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

36.222 kDa

MTTVLGIEGTAWNLSAAIVDEDDVIAEVTETYRPKTGGIHPREAAQHHALHASDVIERLLKEYRDKGHSPENIDAIAFSQGPGLGACLRTVATSARALALSLDIPLVGVNHCIGHVEIGRWKTPAVDPVVLYVSGGNSQVLAHRAGKYRIFGETLDIGIGNALDKFARGAGLTHPGGPKVEEYARKATNYVKMPYVVKGMDFSFSGLSTAATDALKDNSLEDVCYSFQENAFAMLVEVTERALAHTGKSEVLLAGGVGANMRLREMLDLMCEDRGASFYVPERRFMGDNGAMIAYTGLLMFNSGTTLPIENSHVDPSFRPDTVDVTWIADEKEVL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

333 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.474 kDa

MLVLGIESTAHTFSIGIVKDGKILSQLGKTYIPPSGAGIHPREAAEHHARHAPAILRQLLDMLGLALSDVDVVAYAAGPGLGPALRIGAVLARALAIKLGIPLVPVHHGVAHIEVARYTTNACDPLVVLVSGGHTVITGYSDGRYRVFGETLDVAIGNAIDVFAREVGLGFPGVPAVEKCAEAADTVVAFPMPIIGQDLSYAGLVTHALQLVKSGTPLPVVCKSLIETAYYMLAEVVERALAYTKKKEVVVAGGVARSKRLREILSAASGEHDAVVKIVPDEYAGDNGAMIALTGYYAYKHGIYTTPEQSFVKQRWRLDNVDVPWFYDLCNPH

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

332 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.832 kDa

MLVLGVESTAHTISLGLVKDGDVLGQVGKTYVPPSGLGIHPREAADHHSQMAPQLLSHLLYRHGVRLSDVDVVAYAAGPGLGPALRVGAVLARAIAIKLGVPIVPVHHGIAHIEIARYATKSCDPLVVLISGGHTVIAGYSDRRYRIFGETLDVAIGNAIDMFAREAGLGFPGVPAVERCGESADRLVEFPMPIVGQDMSYAGLTTYALKLLKEGVPLSVICKSLVEAAYYMLAEVTERALAFTRKSELVVAGGVARSRRLREILSQVGAYHGAEVKVVPDEYAGDNGAMIALTGYYAYKRGVYTTPEESFVRQRWRLDAVDVPWFWDLCNR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

332 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.08 kDa

MIILGIESTAHTFGVGIVKEENNSIKILANVKDTYIPPQGGMKPSELARHHVEQAPIIVKKALDEAKVNMKDIDGVAVALGPGIGPALRVGATVARALALSFNKKLIPVNHGIAHIEIGMYSTNAKDPLILYLSGGNTIISIFFDRKYRVFGETLDIALGNMIDVFVREAGLAPPYVVNGVHQIDICADKGKEYVELPYIVKGQDMSYSGLLTAALKLLSKRNLPDICYSVREIAFDMLLEATERAMALTGKNEILVVGGVAASVSLKSKLEKLAADRGAELKIVPSQYSGDNGAMIAYTGLLAAKHRVFIPIEKSIIRPRWRIDKVDIPWR

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.558 kDa

MIILGIESTAHTIGVGIVNDNEVLANENETYTPPQGSGIHPREAADHHALKASHLVKRALDKAEVKLSDLDAVAFSQGPGLGPALRVGATVARFIAIKYGKPLVPVHHGVAHIEIAKMTTGAKDPLVLLVSGGHTMVTAYSGGRYRVFGETMDISVGNCLDMFARFLGLPNPGVPHLEECARRGKVMLELPYTVKGQDMSFAGLYTAAVKLVKEGRRVENVCLSIVNTAYYMLAEVTERALALLGKREIVIAGGVARSPILRSIMEIVASEYTATLHVVPPEYAGDNGAMIAWTGLLAYKSGVSISIEDSVIKQRWRIDEVPIPWITSTVS

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

36.4 kDa

MIAMGLEGSANKLGVGIMRDDEILANERLTYAPPPGEGFIPVKTAEHHRSRILGLVAVSLEKAGVDLDDVDIFCYTKGPGMGLPLSVVATVARTLSLYCNKPLVPVNHCIAHIEMGRFITKASNPVILYASGGNTQIIAYHNRRYKIFGETLDIAVGNCIDRFARALKLPNFPAPGLSVERYAKLGKNYIELPYVVKGMDVSFSGILSNIKRKIAEDEQVKRDLCYSLQETVFSALVEVTERAMAFSSSKEVLIVGGVGCNLRLQEMMGIMARERGGVCYATDERFCIDNGVMIAYVGMLMAKSGAAFKLGECFVTQRYRTDSVEVTWRDY

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.931 kDa

MIVLGIESTAHTFGVGVAQDQVPFILANERHTFVPQTGGMKPSEAARHHTLVAHEILRGALDRARISIRDVDGIAVALGPGMGPTLRVGAVVARALSLRFNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTYYRRRFRIFGETLDIALGNMMDTFVREVGLAPPYIVDGKHKIDICAEQGSSIIDLPYTVKGEDMSFSGLLTAALRAVKKHNLHDVCLSLREIAYGMLLEATERALALTEKGEIMIVGGVAASGSLRSKLEKLSNDWGVGLKVVPTSFAGDNGAMIAYAGLLALKHGVHIDVKDSTIRPRWRIDEVDIPWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.558 kDa

MIILGIESTAHTIGVGIVNDNEVLANENETYTPPQGSGIHPREAADHHALKASHLVKRALDKAEVKLSDLDAVAFSQGPGLGPALRVGATVARFIAIKYGKPLVPVHHGVAHIEIAKMTTGAKDPLVLLVSGGHTMVTAYSGGRYRVFGETMDISVGNCLDMFARFLGLPNPGVPHLEECARRGKVMLELPYTVKGQDMSFAGLYTAAVKLVKEGRRVENVCLSIVNTAYYMLAEVTERALALLGKREIVIAGGVARSPILRSIMEIVASEYTATLHVVPPEYAGDNGAMIAWTGLLAYKSGVSISIEDSVIKQRWRIDEVPIPWITSTVS

KAE1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.

Belongs to the KAE1 / TsaD family.

36.4 kDa

MIAMGLEGSANKLGVGIMRDDEILANERLTYAPPPGEGFIPVKTAEHHRSRILGLVAVSLEKAGVDLDDVDIFCYTKGPGMGLPLSVVATVARTLSLYCNKPLVPVNHCIAHIEMGRFITKASNPVILYASGGNTQIIAYHNRRYKIFGETLDIAVGNCIDRFARALKLPNFPAPGLSVERYAKLGKNYIELPYVVKGMDVSFSGILSNIKRKIAEDEQVKRDLCYSLQETVFSALVEVTERAMAFSSSKEVLIVGGVGCNLRLQEMMGIMARERGGVCYATDERFCIDNGVMIAYVGMLMAKSGAAFKLGECFVTQRYRTDSVEVTWRDY

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.931 kDa

MIVLGIESTAHTFGVGVAQDQVPFILANERHTFVPQTGGMKPSEAARHHTLVAHEILRGALDRARISIRDVDGIAVALGPGMGPTLRVGAVVARALSLRFNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTYYRRRFRIFGETLDIALGNMMDTFVREVGLAPPYIVDGKHKIDICAEQGSSIIDLPYTVKGEDMSFSGLLTAALRAVKKHNLHDVCLSLREIAYGMLLEATERALALTEKGEIMIVGGVAASGSLRSKLEKLSNDWGVGLKVVPTSFAGDNGAMIAYAGLLALKHGVHIDVKDSTIRPRWRIDEVDIPWRD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.232 kDa

MLVLGIESTAHTFGVGIAKDQPPYILANERDTFVPKEGGMKPGDLLKHHAEVSGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.29 kDa

MFVLGIESTAHTFGVGIVRDSPPYILANERDTFIPKEGGMKPGDLLKHHAEVSATILRRALEKAKISINDINYIAVALGPGIGPALRVGATLARAIALKYNKKLVPVNHGIGHIEIGYLTTEARDPLILYLSGGNTIITTFYKGRFRVFGETLDIALGNMMDVFVREVSLAPPYIINGIHVIDICAEKGNKLLKLPYVVKGQDMSFSGLLTAALRVVGKEKLEDICYSVREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWNVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.198 kDa

MLVLGIESTAHTLGVGIAKDQPPYILANERDTFVPKEGGMKPGDLLKHHAEVSGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.198 kDa

MLVLGIESTAHTLGVGIAKDQPPYILANERDTFVPKEGGMKPGDLLKHHAEVSGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.232 kDa

MLVLGIESTAHTFGVGIAKDQPPYILANERDTFVPKEGGMKPGDLLKHHAEVSGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.198 kDa

MLVLGIESTAHTLGVGIAKDQPPYILANERDTFVPKEGGMKPGDLLKHHAEVSGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHGIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

331 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

36.204 kDa

MLVLGIESTAHTFGVGIAKDQPPYILANERDAFVPKEGGMKPGDLLKHHAEASGTILRRALEKANISINDINYIAVALGPGIGPALRVGATLARALSLKYNKKLVPVNHSIGHIEIGYLTTEAKDPLILYLSGGNTIITTFYKGRFRIFGETLDIALGNMMDVFVREVNLAPPYIINGKHAIDICSEKGSKLLKLPYVVKGQDMSFSGLLTAALRLVGKEKLEDICYSIREIAFDMLLEATERALALTSKKELMIVGGVAASVSLRKKLEELGKEWDVQIKIVPPEFAGDNGAMIAYAGMLAASKGVFIDVDKSYIRPRWRVDEVDIPWRN

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

329 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.85 kDa

MYVLGIESTAHTIGVGIVNERAEVLANEMHTYVPKEGGIHPREAARHHAEWGPRLVKRALEVAGLRPEDLDAVAYSAGPGLGPCLRTGAVMARALAAFYEKPLVPVNHSLAHIEIARAVTGFSKPVAIYVSGGSTIISAPAIKRYRVYGETLDIGLGNLLDTFAREVGIGPPFVKGGVHVVELCSEGAEEPADLPYTVQGVDLSFSGLLTAALRAWKKEDKKKVCYGLWETAYDMVVEVGERALAHSKLKEVVLVGGVAGSKRLQRKVALMSEERGVSFKPIPYELARDNGAMIAWTGLLYYKHGFTVAPEEAFVRQRWRLDEVEVPWL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

329 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.85 kDa

MYVLGIESTAHTIGVGIVNERAEVLANEMHTYVPKEGGIHPREAARHHAEWGPRLVKRALEVAGLRPEDLDAVAYSAGPGLGPCLRTGAVMARALAAFYEKPLVPVNHSLAHIEIARAVTGFSKPVAIYVSGGSTIISAPAIKRYRVYGETLDIGLGNLLDTFAREVGIGPPFVKGGVHVVELCSEGAEEPADLPYTVQGVDLSFSGLLTAALRAWKKEDKKKVCYGLWETAYDMVVEVGERALAHSKLKEVVLVGGVAGSKRLQRKVALMSEERGVSFKPIPYELARDNGAMIAWTGLLYYKHGFTVAPEEAFVRQRWRLDEVEVPWL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

325 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.249 kDa

MIALGIEGTAHTLGIGIVTEKKVLANVFDTLTTEKGGIHPKEAAEHHARLLKPLLRKALQTAGITMEDVDVIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDTFARELGIGFPGGPKIEKLALKGERYIELPSAVKGMDLSFSGLLTEAVRKYRTGRYRVEDLAYSFQETAFSALVEVTERAVAHTGKNEVVLVGGVAANNRLREMLKIMAEDRGVEFFVPPYDLCRDNGAMIAYTGLRMYLGGVRFKISDTVVKQKFRTDEVDVTWS

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

325 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.366 kDa

MIALGIEGTAHTLGIGIVTEKSVLANVFDTLTTEKGGIHPKEAAEHHARLLKPLLRKALETAGVTMEDVDLIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDTFARELGIGFPGGPKIEKLALKGEKYIELPYAVKGMDLSFSGVLTEAVRKYRTGKYRIEDLAYSFQETAFAALVEVTERAVAHTGKEEVVLVGGVAANNRLREMLKIMAEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYRGGVRFKIEDTVVKQKFRTDEVEVVWD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

325 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.383 kDa

MIALGIEGTAHTLGIGIVTEKKVLANVFDTLTTEKGGIHPKEAAEHHARLLKPLLRKALDEAGITIEDVDMIAFSQGPGLGPSLRVVATAARALAIKHNKPIIGVNHCIAHVEIAKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDTFAREIGIGFPGGPKIEKLALEGEKYIELPYAVKGMDLSFSGILTEAVRKYRTGRYRVEDLAYSFQETAFAALVEVTERAVAHTGKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYLGGVKFNLEETVVKQKFRTDEVEVVWS

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.305 kDa

MYVLGIEGTAWNLSAAIVNEDDVIIERAATYTPARGGIHPREAAQHHSEHIGPLLREVIQGARDLGIKIDGVAFSQGPGLGPCLRTVATAARVLALKLNVPLVGVNHCIAHIEIGKWKTGARDPAVLYVSGGNSQVLALRRGRYRIFGETLDISVGNMLDKFARSVGLPHPGGPRIEELARNAKEYIPLPYTVKGMDFSFSGLATAAAEAARRYDLEDVCYSLQETAFAMLVEVTERAMAHAEKKEAMLVGGVGANRRLGEMLRLMCEERGARFYLPERRFMGDNGSMIAYTGLVMLKSGVSTPIESSGVRPNYRTDEVEVRWA

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.305 kDa

MYVLGIEGTAWNLSAAIVNEDDVIIERAATYTPARGGIHPREAAQHHSEHIGPLLREVIQGARDLGIKIDGVAFSQGPGLGPCLRTVATAARVLALKLNVPLVGVNHCIAHIEIGKWKTGARDPAVLYVSGGNSQVLALRRGRYRIFGETLDISVGNMLDKFARSVGLPHPGGPRIEELARNAKEYIPLPYTVKGMDFSFSGLATAAAEAARRYDLEDVCYSLQETAFAMLVEVTERAMAHAEKKEAMLVGGVGANRRLGEMLRLMCEERGARFYLPERRFMGDNGSMIAYTGLVMLKSGVSTPIESSGVRPNYRTDEVEVRWA

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.508 kDa

MIALGIEGTAHTLGIGIVTEDKVLANVFNTLTTEKGGIHPKEAAEHHAKLLRPLLKKALQEAKVNIKDVDVIAFSQGPGLGPALRVVATAARALALRYNKPIVGVNHCIAHVEVTKMFGIKDPVGLYVSGGNTQILALEGGRYRVFGETLDIGIGNAIDTFAREIGLGFPGGPKIEKLAQRGEKYIELPYTVKGMDLSFSGILTEAVRKYKTGKYKLEDIAYSFQETAFAALIEVTERAVAHTGKEEVVLVGGVAANNRLREMLKTMSEERSIKFFVPPYDLCRDNGAMIAYNGLRMFKAGIRFNIEETIVKQKFRTDEMEVTW

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. In vitro, binds tRNA, ssRNA, both single- and double-stranded DNA, and exhibits a low ATPase activity.

Belongs to the KAE1 / TsaD family.

35.368 kDa

MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVW

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.361 kDa

MIALGIEGTAHTLGIGIVTENKVLANVFDTLKTEKGGIHPKEAAEHHAKLLKPLLRKALEEAGVSMEDIDVIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNALDVFARELGLGFPGGPKIEKLALKGEKYIELPYAVKGMDLSFSGLLTEAIRKYKSGKYRVEDLAYSFQETAFAALVEVTERALAHTEKEEVVLVGGVAANNRLREMLRIMAEDRGVKFFVPPYDLCRDNGAMIAYTGLRMYKAGIKFKLEETIVKQKFRTDEVEVVW

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

324 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.306 kDa

MLALGIEGTAHTLGIGIVSEKKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLKKALEKAGISMDDIDVIAFSQGPGLGPALRVVATAARALAIRYNKPIVGVNHCIAHVEITKMFGIKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKLEKLAEKGKNYIDLPYAVKGMDLSFSGLLTEAIRKYRSGKFRVEDLAYSFQETAFAALVEVTERALAHTEKKEVVLVGGVAANNRLREMLKIMAEDRGVKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFPLEKTIVKQKFRTDEVEITW

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

323 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.097 kDa

MQCSRVLGIEGTAWSLSAAIVGWDKVYAEASHPYVPETGGIHPMAAAQHHASHVSQIVRQVLDSGYDFDGVAFSRGPGLGPCLRTVATAARALALAYDVPLMGVNHCVAHIEVGRWQTGCHDPVVLYVSGANSQVIAFRRGRYRVFGETLDIGIGNALDKFGRHLGLQHPGGPKIEALAREGKNYIHLPYVVKGMDLSYSGMMSAAKEAAAKYLKEDVCFSLQENAFAMLVEVTERALAHTGKNEVLIGGGVGANMRLQSMLDTMCRDRGAKFYAPPRKFFGDNGSMIAYTGLLQLKYDQTIPVEDSAVNPIYRTDEVEIPWL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

323 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.097 kDa

MQCSRVLGIEGTAWSLSAAIVGWDKVYAEASHPYVPETGGIHPMAAAQHHASHVSQIVRQVLDSGYDFDGVAFSRGPGLGPCLRTVATAARALALAYDVPLMGVNHCVAHIEVGRWQTGCHDPVVLYVSGANSQVIAFRRGRYRVFGETLDIGIGNALDKFGRHLGLQHPGGPKIEALAREGKNYIHLPYVVKGMDLSYSGMMSAAKEAAAKYLKEDVCFSLQENAFAMLVEVTERALAHTGKNEVLIGGGVGANMRLQSMLDTMCRDRGAKFYAPPRKFFGDNGSMIAYTGLLQLKYDQTIPVEDSAVNPIYRTDEVEIPWL

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

323 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.

Belongs to the KAE1 / TsaD family.

35.604 kDa

MIALGIEGTAWSLSIGVVDEEGVIALENDPYIPKEGGIHPREASQHHSERLPSLLSRVFEKVDKNSIDVVAFSQGPGMGPCLRVVATAARLLAIKLEKPLVGVNHCLAHVEVGRWQTGARKPVSLYVSGGNSQVIARRGNRYRVFGETLDIGIGNALDKLARHMGLKHPGGPKIEELAKKGQKYHFLPYVVKGMDFSFSGMVTAAQRLFDSGVRMEDVAFSFQETAFAMLTEVTERALAYLDLNEVLLVGGVAANKRLQEMLRIMCEDRGAKFYVPPKELAGDNGAMIAYTGLLMYKHGHQTPVEKSYVRPDFRIEDVEVNWD

kae1

tRNA N6-adenosine threonylcarbamoyltransferase

314 amino acids

Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37.

Belongs to the KAE1 / TsaD family.

35.467 kDa

MKVLGIECTAHTFGVGIFDSEKGVLANEKVTYKGYGIHPREAAELHLKEFDKVLLKALEKANISLKDIDLIAVSSGPGLLPTLKLGNYIAVYLGKKLNKPVIGVNHIVAHNEFARYLAKAKDPLFVYVSGANTQFLAIVNNSWFLVGETLDMGVGNLIDKVARDLGLEFPGGPKIEELAKKGKNLIELPYTIKGLNLQLGGIYTYIKRIKDQYSKEDIAYSLQEWVFALILEIAERAMHMLDKKELILTGGVACNNRLNDMAEQMAKENNFKFYRLPCQYLTDNGAMIAYLGYYWYSQGIYYEPKPRPYWRIWI