About Products Protein Database Contact

Protein expression services for KAE1 | tRNA N6-adenosine threonylcarbamoyltransferase

Description
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. KAE1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators.
Family
Belongs to the KAE1 / TsaD family.
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
Length
373 amino acids
Sequence
MTVDLDQYAKPGKDYYLALGLEGSANKLGVGVIKHNLGQLSLDNRAEILSNVRDTYVTPPGEGFLPRDTARHHRNWAVRIIKKALIEAKVKGSDLDCICFTQGPGMGAPLQSVVIAARTLSQLWDLPLVGVNHCVGHIEMGREITGADNPVVLYVSGGNTQVIAYSRQRYRIFGETLDIAIGNCLDRFARTLRIPNEPAPGYNIEQMAKKGKHLVPLPYTVKGMDLSMSGILAHVDSLAKDLFAENKNKKLIDDETGEQITSEDLCFSLQETLFSMLVEITERAMAHVQSNQVLIVGGVGSNERLQQMMELMVNDRKNGSIFATDERFCIDNGIMIAHAGLLGYRMGQTNELWNTVCTQRFRTDEVFVKWRDD
Mass
41.4 kDa
Simulated SDS-PAGE
Western blot of KAE1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make KAE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here