Description
Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of the KEOPS complex that is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Kae1 likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.
Family
Belongs to the KAE1 / TsaD family.
Species
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Sequence
MIALGIEGTAHTLGIGIVTEKKVLANVFDTLTTEKGGIHPKEAAEHHARLLKPLLRKALQTAGITMEDVDVIAFSQGPGLGPALRVVATAARALAIKYNKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDTFARELGIGFPGGPKIEKLALKGERYIELPSAVKGMDLSFSGLLTEAVRKYRTGRYRVEDLAYSFQETAFSALVEVTERAVAHTGKNEVVLVGGVAANNRLREMLKIMAEDRGVEFFVPPYDLCRDNGAMIAYTGLRMYLGGVRFKISDTVVKQKFRTDEVDVTWS
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service