hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.525 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMIYNSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.484 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.484 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.511 kDa

MSRISSLQDPFLNALRKEKVNVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.484 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.484 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.525 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMIYNSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.484 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNSNDEQDENVDDIHSDDLEIQENEGNIHE

hfq

RNA-binding protein Hfq

109 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

12.502 kDa

MSRISSLQDPFLNALRKEKVSVSVYLVNGIKLQGQVEAFDQFCIVLRNTVNQMVYKHAISTIVPAKSVRMVYSSFNPYHQNANDDQDENVDDIHSDELEVQENQENINE

hfq

RNA-binding protein Hfq

106 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.854 kDa

MSKSQSLQDPYLNALRKERVPVSIYLVNGIKLQGQIESFDAFVILLRNNISQMVYKHAVSTIVPSRNIHLSREEMGLEDEAGEEISAEYTPNAEGQAEATADPLYD

hfq

RNA-binding protein Hfq

106 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.317 kDa

MDNKPAQNIQDTFLNTVRKDKTPITIYLVSGVKLTGKIRSFDKYSVLLENNSQEQLIFKHAISTVVSSRSVLHGDHRPGVAGHGAPPISPTPPAGTHSTPGESSGA

hfq

RNA-binding protein Hfq

103 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.102 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTGSNFHHGSNAQGSSAPAQDSDETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.196 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNASGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.192 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSPQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Involved in the regulation of stress responses mediated by the sigma factors RpoS, sigma-E and sigma-32 (PubMed:17158661). Binds with high specificity to tRNAs (PubMed:18230766). Binds sRNA antitoxin RalA (PubMed:24748661). In vitro, stimulates synthesis of long tails by poly(A) polymerase I (PubMed:10677490). Required for RNA phage Qbeta replication (PubMed:805130). Seems to play a role in persister cell formation; upon overexpression decreases persister cell formation while deletion increases persister formation (PubMed:19909729).

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.209 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGSTSSNYHHGSSAQNTSAQQDSEENE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.112 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNTGGGSNNYHHGSSPAPSSQPQQDSADAE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Plays a central regulatory role in the microbial response to space flight conditions. Is essential for virulence and is required for efficient invasion of non-phagocytic cells.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.266 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGGTSNYHHGNNPSAPQQPQQESDDAE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.131 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGSNNYHHSNNAQPSSAASQDSEDAE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.166 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.965 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSSNTSVGASVGNYHSGGVSAPAAQQESDGTE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.109 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQGTSAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.119 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSNNYHHGSNAQGSGAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.161 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNVQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.161 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNVQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.119 kDa

MAKGQSLQDPFVNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGASNNYHHGSNAQGSTAQQDSEETE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.003 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGSSNYHHGGSAQGSSAPQQDSDDAE

hfq

RNA-binding protein Hfq

102 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.003 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGSSNYHHGGSAQGSSAPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.165 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFIILLKNTVSQMVYKHAISTVVPARSISHNNNGSSQAQAPQQAVQTTQPVEAIVATDKME

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.071 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSPPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.082 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHNNNPSGGSSNYHHGSTPASQPSQPESDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.143 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Positively regulates the expression of the yst gene for heat-stable enterotoxin (Y-ST).

Belongs to the Hfq family.

11.143 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

101 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.13 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGSTNNYHGSNPSAPQQPQQDSDDAE

hfq

RNA-binding protein Hfq

99 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.04 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNNAQQQYQQQAAQAASAQSNETSSQAE

hfq

RNA-binding protein Hfq

99 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

11.225 kDa

MAKGNLNLQDLFLNQLRKEKVNVTIFLLSGFQLKGVIKGFDNFTLVVETENNKQQLIYKHAISSILPSKPINYMAQVQNSQVQNTASQQSNNNQNQESK

hfq

RNA-binding protein Hfq

99 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.834 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNPGGGSNYHGNNTAASQQSQEADDAE

hfq

RNA-binding protein Hfq

99 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.921 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNPGGSNNYHGSNTTAQQQSQDADDAE

hfq

RNA-binding protein Hfq

99 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Involved in the regulation of the bacteriocin carotovoricin.

Belongs to the Hfq family.

10.963 kDa

MVKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNPGGSNNYHGSNTTAQQQSQEADDAE

hfq

RNA-binding protein Hfq

98 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.906 kDa

MAKEPTQNVQDVFLNHVRRSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKHAISTVMPATPVVLFDPSRTEGATVDLTEKDLAGDADLL

hfq

RNA-binding protein Hfq

97 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.783 kDa

MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTIVPARSVNLQHENKPQAAPASTLVQVETVQQPAE

hfq

RNA-binding protein Hfq

97 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.841 kDa

MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTIVPARSVNLQHENRPQAAPTSTLVQVETVQQPAE

hfq

RNA-binding protein Hfq

97 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.841 kDa

MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTIVPARSVNLQHENRPQAAPTSTLVQVETVQQPAE

hfq

RNA-binding protein Hfq

97 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.811 kDa

MTAKGQMLQDPFLNALRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLRNTSVTQMVYKHAISTIVPARSVNLQHENRPQAAPASTLVQVETVQQPAE

hfq

RNA-binding protein Hfq

96 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.945 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNSVQHHHIVQTQEMQVEALAENQTE

hfq

RNA-binding protein Hfq

96 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.762 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNPQQQQQHSQQTESAAPAAEPQAE

hfq

RNA-binding protein Hfq

96 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.514 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNTGTNQAGTNYSGGNATQQDDVAE

hfq

RNA-binding protein Hfq

96 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.956 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNSNNSNQQNYQQEQQTDSNVEKAE

hfq

RNA-binding protein Hfq

96 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.945 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNSVQHHHIVQTQEMQAEVLAENQTE

hfq

RNA-binding protein Hfq

94 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.279 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVSAHHSSPAPTPAGGFNGQNDETSE

hfq

RNA-binding protein Hfq

93 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.361 kDa

MASEKSQNVQDVFLNHVRKSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKHAISTVMPGAPIQLFDATKPEGDLGRDTAAYSDE

hfq

RNA-binding protein Hfq

93 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.351 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAISHNNNSNHAHQAAPVQSAEVVEKVE

hfq

RNA-binding protein Hfq

93 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.226 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVNSHTAAPSPAGGFNGQQDDNNDQ

hfq

RNA-binding protein Hfq

93 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.951 kDa

MSKGHSLQDPFLNALRKERIPVSIFLVNGIKLQGQIESFDQYVVLLKNAVSQMVYKHAISTVVPARNPRATGNPAMAAGATAAPAADEGYGNQ

hfq

RNA-binding protein Hfq

93 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.211 kDa

MAKGQSLQDPFLNALRKERIPVSIYLINGIKLQGQIESFDQFVILLKSTSPSLKNTICQVIYKHAVSTVVPSRAVSSSPHHAPPLQKPEDDGS

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.516 kDa

MALAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPKKQETAQEAETSENEGS

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.516 kDa

MALAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPKKQETAQEAETSENEGS

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.329 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNVSNHQATNAQAGYNAQHDETDEK

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.241 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNVSNHQATNAQAGFNAQHDDGDDK

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.194 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVSSHHNTPNQAAGYNASHDDSAE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.271 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNVSNHQATNAQAGYNAQHDDGDEK

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.075 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSVSHNNGGTSHTQQAPAVEAVADKAE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.075 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSVSHNNGGTSHTQQAPAVEAVADKAE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.045 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARSVSHNNGGAAHTQQSPAVEAVADKAE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.371 kDa

MAKGSLNLQDLFLNQLRKEKVNVTIFLLSGFQLKGVIKGFDNFTLIVETDNNKQQLIYKHAISSIMPSKPINYMAQAQNNQQASQQSNNNQG

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.146 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.146 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.203 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNENNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.203 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNENNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.203 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNENNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.146 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.146 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.128 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVHSGSDTLQINDDEVE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.133 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVQSGSDTLQINDDEVE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.128 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVHSGSDTLQINDDEVE

hfq

RNA-binding protein Hfq

92 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.128 kDa

MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVRVGPGGGYVHSGSDTLQINDDEVE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.28 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNNHHTTPTEAVENVETQAE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.28 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNNHHTTPTEAVENVETQAE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.28 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNNHHTTPTEAVENVETQAE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.25 kDa

MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARSVSHHNNNHHTAPTEAVENVETQAE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.806 kDa

MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVKVGPGGGYVQSGEGGQAGDEADE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.806 kDa

MSKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAISTVVPARNVKVGPGGGYVQSGEGGQAGDEADE

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.036 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRPFNVGSHQGGSSNYNAQQDDSAGEQ

hfq

RNA-binding protein Hfq

91 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.606 kDa

MTEKFNLQDRFLNMLRTGKIEVKVYLVNGFQTKGIIRSFDSYTILLESENQQNLIYKHAISTIMPSSFVRLVKKEEEEQEGQTESATNKTQ

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.36 kDa

MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPRKQETAQEAETSENEGS

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.468 kDa

MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPRKQEPEKEDETPEDQGS

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.36 kDa

MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPRKQETAQEAETSENEGS

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.468 kDa

MAEKFNLQDRFLNHLRVNKIEVKVYLVNGFQTKGFIRSFDSYTVLLESGNQQSLIYKHAISTIIPSSYVMLMPRKQEPEKEDETPEDQGS

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.068 kDa

MSHDKKQNLQDVFLNSVRKTKTPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGLSQLVYKHAISTIMPAAPVSLFEDDKADDDAAEESATD

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.873 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVAGHQNAQGGYGAQDDMPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.873 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVAGHQNAQGGYGAQDDMPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.873 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVAGHQNAQGGYGAQDDMPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.897 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGPQDDVPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.939 kDa

MTKASASLQDGFLNLLRRENIPATIYLVNGYQLKGYIRGFDNFTVAVEVDGRVQLVYKHALSTITPARPLPVSVSQIMRAGEGQEVEGEE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.843 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGAQDDAPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.843 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGAQDDAPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.843 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGAQDDAPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.843 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGAQDDAPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.873 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVAGHQNAQGGYGAQDDMPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.897 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVTGHQNAQGGYGPQDDVPSGE

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.909 kDa

MSRGQSLQDPFLNALRKERVPVSIYLVNGIKLQGQIESFDQFVVLLKNSVSQMVYKHAISTVVPARNVKLSSNEGENIHPIGGTRSADAD

hfq

RNA-binding protein Hfq

90 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.125 kDa

MAKGQSLQEPFLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLRNNVNQMVYKHAISTIVPARRVRLPQQGEEASAESIVGEEESNN

hfq

RNA-binding protein Hfq

89 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.888 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARALHITPTQSSQPGYVQHDDAPAE

hfq

RNA-binding protein Hfq

89 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.947 kDa

MAKGQSLQEPFLNALRKEKVPVSIYLVNGIKLQGQIESFDQFVILLRNNVNQMVYKHAISTVVPARNVRTAPPVPTETHAQSSEEFGNI

hfq

RNA-binding protein Hfq

89 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.124 kDa

MENKKVAKALPIQDPYLNALRKEKINVAIYLVNGVKLQGRVDSFDQFVVLLRSNVTQMVYKHAISTIVPARDPKAYEFEAQETEAKDSE

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.942 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSHHSGEQQRAPSDRPEKTED

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.942 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSHHSGEQQRAPSDRPEKTED

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.383 kDa

MAKEKFNLQDRFLNILRTKKIEVKVYLVNGFQTKGIVRSFDNFTVLIESGKQQTLIYKHAISTILPAEYIMLMKTEEEQQEQQEAEQE

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.956 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSHHSASDRPQGERPQEKTEE

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.956 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSHHSASDRPQGERPQEKTEE

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.89 kDa

MAKGQSLQDPFLNALRCERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARAVSHHTASDRPQGERPQETTEE

hfq

RNA-binding protein Hfq

88 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.752 kDa

MSKGHSLQDPYLNVLRKERVPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAISTVVPSRAVRVPLLNEAGGAEGEEDEQAE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.699 kDa

MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAISTVVPSRPVRVPMLNPESTGNDDMESGA

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPQGDRPQEKSED

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Essential for virulence in the suckling mouse model of cholera pathogenesis.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPQGDRPQEKSED

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.699 kDa

MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAISTVVPSRPVRVPMLNPESTGNDDMESGA

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPQGDRPQEKSED

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Essential for virulence in the suckling mouse model of cholera pathogenesis.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.769 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPASDRPAEKSEE

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGDRPQGDRPQEKSED

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.564 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAVNHHQHAPGAAGEEQGEAEA

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.592 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARAVNHHQHVPGAAGEEQGEAEA

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.741 kDa

MAKGQSLQDPFLNALRRERIPVSIFLVNGIKLQGKIQSFDQFVILLENTVNQMVYKHAISTVVPARAVNFQGVQENDDTEEPEAGNI

hfq

RNA-binding protein Hfq

87 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.975 kDa

MAKGQSLQDPFLNTLRRERIPVSIYLVNGIKLQGYIESFDQFVILLKNSISQMIYKHAISTVVPNHTNNQEHNQSQYNNNNACISKP

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.012 kDa

MAEKFNLQDRFLNILRTSKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGNQQNLIYKHAVSTIMPESFVRLTSKQQQEGKDSDEEE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.761 kDa

MASSKAAINLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQQLLIYKHAISTITPQKPVIFSASDKDEKREE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.761 kDa

MASSKAAINLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQQLLIYKHAISTITPQKPVIFSASDKDEKREE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.674 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGERGSDRPSEKSED

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

10.012 kDa

MAEKFNLQDRFLNILRTSKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGNQQNLIYKHAVSTIMPESFVRLTSKQQQEGKDSDEEE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.761 kDa

MASSKAAINLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQQLLIYKHAISTITPQKPVIFSASDKDEKREE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.761 kDa

MASSKAAINLQDIFLNQVRKEHVPVTVYLINGFQLKGLVKGFDNFTVVLESENKQQLLIYKHAISTITPQKPVIFSASDKDEKREE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.674 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGERGSDRPSEKSED

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.462 kDa

MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRLPSPTDSEHGDSEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.398 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSATESEAGDAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.432 kDa

MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRLPSPTDGEHGDSEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.462 kDa

MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRLPSPTDSEHGDSEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.448 kDa

MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGSIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRLPSPSDSEHGDSEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.354 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSATDADGADAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.354 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSATDADGADAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.666 kDa

MASSKAAINLQDIFLNQVRKEHVPVTVYLINGFQLKGTVKGFDNFTVVLESESKQQLLIYKHAISTISPQKPVIFSGSEKDDKKEE

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.721 kDa

MSSKGQMLQDPFLNILRKEHVPVSIYLVNGIKLQGQVESFDQYVVLLKNTVTQMVYKHAISTVVPARPVNIPHEHPAQKQEQAQDA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.903 kDa

MKNTVLNLQDLFLNNARKERIPVTIYLVNGVQVKGLVKGFDSYIILIEGDNRQQNMIYKHAVSTIQPGKYINLTNQNQNNNNNNNR

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.354 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSATDADGADAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.473 kDa

MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAISTVVPARPVRLPSPSDAEHGDSEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.441 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSASESEQGDAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.324 kDa

MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAISTVVPVRPIRLPSAAGDDAADAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.48 kDa

MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPSAGDSEQADAEPGNA

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.494 kDa

MSKGHSLQDPYLNVLRKERIPVSIYLVNGIKLQGQVESFDQFVVLLKNTVSQMVYKHAISTVVPSRPVRVPLLNADGTSAEDENGG

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.844 kDa

MAQGQSLQDIFLNVLRRERIQVSIYLFNGIKLQGHIESFDQFVIVLKNTISQMVYKHAVSTIVPSKFVSHYANNSSNYSNHSGDRN

hfq

RNA-binding protein Hfq

86 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.674 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVSHHSGERGSDRPSEKSED

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Seems to be involved in the regulation of NifA.

Belongs to the Hfq family.

9.621 kDa

MAAERTQNLQDTFLNHVRKSKTPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFDPTDEVASEKA

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.346 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPVAHHTAPAAGDSDSQSEE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.346 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPVAHHTAPAAGDSDSQSEE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.532 kDa

MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQSLVYKHAISTIIPAKIIKLYTEEAKDNKDAAQG

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.532 kDa

MSAKNNIQDQLLNTARKDKLDLTIYLLNGVPLKGKVVSFDNFTIVLEQENKQSLVYKHAISTIIPAKIIKLYTEEAKDNKDAAQG

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.409 kDa

MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPARPFNVSAHQGTAHGEESDAE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.582 kDa

MSKNQLNLQDAFLNQVRKENVGVTIFLINGFQLKGFVKGFDNFTVILESEGKQHMIYKHAISTIIPQRPVNTYLAKGGNEENTPS

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.649 kDa

MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAISTVVPARPVNHHHASDRPATLEKTEE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.664 kDa

MTKVVNNLQDIFLNGARKNRIPVTIYLTNGFQLKGFVKGFDNFTVILDSDGKQMMIYKHAISTINPAKPLLFVQNPNGDDYKDKE

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.615 kDa

MAKGQTLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAISTVVPARIPQNYLPQQAGEDMAEIED

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.403 kDa

MSAKGQMLQDPFLNILRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLKNTVTQMVYKHAISTVVPARPVQVPHEHPAPAAGTAEI

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.528 kDa

MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.528 kDa

MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.528 kDa

MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD

hfq

RNA-binding protein Hfq

85 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.528 kDa

MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVMLKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.348 kDa

MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPTASEGEQPEPGNA

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAEKFNLQDRFLNILRTNKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGSQQNLIYKHAVSTIMPESFVKLTKQQNEESENEEK

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.351 kDa

MSNKGQLLQEPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVFKHAISTIVPGRAVHFSTAEPADANSNNG

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.839 kDa

MAEKFNLQDRFLNILRTNKIPVKVYLVNGFQTKGIIRSFDNFTMLLENGSQQNLIYKHAVSTIMPESFVKLTKQQNEESENEEK

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.351 kDa

MSNKGQLLQEPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVFKHAISTIVPGRAVHFSTAEPADANSNNG

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.561 kDa

MSAEKSQNVQDVFLNFIRKNKTPVTIFLVNGVKLQGIVTWFDNFSVLLRRDGHTQLVYKHAISTVMPSTPISLFEPPIKENGEE

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.541 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEPDETAPEKA

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.541 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEPDETAPEKA

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.488 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEQGEEGAEKG

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.541 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEPDETAPEKA

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.488 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEQGEEGAEKG

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.527 kDa

MNKTQGNLQDLFLNVLRRDNTPVTIYLVNGFQLKGVVRGFDNFTVVLDADGKQQMIYKHAISTIMPFRPVNLMAESRAQAEAKQ

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.646 kDa

MSKNTINLQDNVLNQVRKNKITVTIFLVNGYKIRGLIKSFDNFTLLMEVNGEQQMIYKHAVSTIIPGKTLNLFSDQSDKNDQEQ

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.312 kDa

MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPGRPVRLPTAGDAEQSESGND

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.41 kDa

MAVDRPQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGAPIQMFEPGDEAGHAG

hfq

RNA-binding protein Hfq

84 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.378 kDa

MGVKGQLLQDPFLNILRKERIPVSIYLVNGIKLQGQIDSFDQYVVLLKNSVTQMVYKHAISTIVPAKAISIPIPADTQTEQDEP

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.172 kDa

MSKGQSLQDPYLNALRKERIPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARNVRIAAQGEGENEASNA

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.291 kDa

MSKGHSLQDPYLNALRKERIPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPARNVRLPQQNPAGEGESED

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.444 kDa

MAGERAQNLQDTFLNHVRKNKIPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFEPDETAEKA

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.35 kDa

MAAERPQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGQPIQMFESGEDAAAS

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.653 kDa

MKATYNIQDYFLNQLRKDSVPTTVFLISGYQLRGLIKSFDNFTVILESEGKQQLIYKHAISTFAPARNVTLYEQETETEEVTR

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.089 kDa

MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVNFSTAEAAGSDASA

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.258 kDa

MSKTQINLQDAFLNQLRKENIPVTIFLVNGFQLKGAVRGFDNFTVILESDGKQLMVYKHAISTVSPSRPVNTSATPEHRNVGQ

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.456 kDa

MNKAPINLQDTFLNQVRKENMPVTIYLVNGFQLKGLVRGFDNFTVVIEFEGKQQMVYKHAISTVMPLRPINLVAASQSSTEER

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.41 kDa

MNKAPINLQDTFLNQVRKENMPVTIYLVNGFQLKGLVRGFDNFTVVIEFEGKQQMVYKHAISTVMPLRPINLVAASQASAEER

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.201 kDa

MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVNFSTAEPADAESGN

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.228 kDa

MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVNFSTAEPAADGDNQ

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.228 kDa

MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVNFSTAEPAADGDNQ

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.379 kDa

MSKGQSLQDPYLNILRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAISTVVPSRNVRLPVQDPNAPAEEDS

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.284 kDa

MTKPQINLQDAFLNQVRKENIPVTIFLVNGFQLKGMVRGFDNFTVILESEGKQLMVYKHAISTVSPLKPVSTSFSEAKAPEKS

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.234 kDa

MSNNKGQLLQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTIVPGRAVSFATGESEESPAS

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.162 kDa

MAKGQSLQDPFLNALRKERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRALPVAATNPHADADENQ

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.

9.066 kDa

MAKGQSLQDPFLNALRRDRIPVAIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAISTVVPSRAVNTAPVPGPDDQSSDA

hfq

RNA-binding protein Hfq

83 amino acids

RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs.

Belongs to the Hfq family.