About Products Protein Database Contact

Protein expression services for hfq | RNA-binding protein Hfq

Description
RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs (By similarity). Seems to be involved in the regulation of NifA.
Family
Belongs to the Hfq family.
Species
Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
Length
85 amino acids
Sequence
MAAERTQNLQDTFLNHVRKSKTPLTIFLVNGVKLQGVVTWFDNFCVLLRRDGHSQLVYKHAISTIMPGHPVQLFDPTDEVASEKA
Mass
9.6 kDa
Simulated SDS-PAGE
Western blot of hfq recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make hfq using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here