csoR

Copper-sensing transcriptional repressor CsoR

119 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region (By similarity).

Belongs to the CsoR family.

12.8 kDa

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM

csoR

Copper-sensing transcriptional repressor CsoR

119 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region (By similarity).

Belongs to the CsoR family.

12.8 kDa

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM

csoR

Copper-sensing transcriptional repressor CsoR

119 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region (By similarity).

Belongs to the CsoR family.

12.8 kDa

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM

csoR

Copper-sensing transcriptional repressor CsoR

119 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes (By similarity).

Belongs to the CsoR family.

12.8 kDa

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM

csoR

Copper-sensing transcriptional repressor CsoR

119 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region.

Belongs to the CsoR family.

12.8 kDa

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM

csoR

Copper-sensing transcriptional repressor CsoR

117 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region (By similarity).

Belongs to the CsoR family.

12.534 kDa

MSHELTDKKRAALNRLKTARGHLDGIIRMLESDAYCVDVMKQLSAVQSSLERANRVMLHNHLETCFSAAVLDGRGQAAIDELIDAVKFTPALTGPQAQLGGAVVCKPPGDQPAQSPA

csoR

Copper-sensing transcriptional repressor CsoR

101 amino acids

Copper-sensitive repressor that has a key role in copper homeostasis. Negatively regulates expression of the copZA operon and of ycnJ. In the absence of copper ions, binds with high affinity to the copZA promoter and represses the transcription. In the presence of copper ions, CsoR binds Cu(1+), which significantly decreases its DNA binding affinity and leads to the transcription of the genes.

Belongs to the CsoR family.

11.475 kDa

MEKHNEHKTLNHKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMKNVALHLLEDHAHHCVADAIKSGDGEQAISELLDVFKKFTKS