Copper-sensitive repressor that has a key role in copper homeostasis. Negatively regulates expression of the copZA operon and of ycnJ. In the absence of copper ions, binds with high affinity to the copZA promoter and represses the transcription. In the presence of copper ions, CsoR binds Cu(1+), which significantly decreases its DNA binding affinity and leads to the transcription of the genes.

Belongs to the CsoR family.

101 amino acids

MEKHNEHKTLNHKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMKNVALHLLEDHAHHCVADAIKSGDGEQAISELLDVFKKFTKS

11.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csoR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here