Copper-sensitive repressor that has a key role in copper homeostasis. It is part of the cso operon involved in the cellular response to increasing concentrations of copper inside the bacterium, which can be highly toxic. In the presence of copper, CsoR fully dissociates from the promoter in the cso operon, leading to the transcription of its genes. Binds to a GC-rich pseudopallindromic sequence, 5'-GTAGCCCACCCCCAGTGGGGTGGGA-3', in the cso promoter region (By similarity).

Belongs to the CsoR family.

117 amino acids

MSHELTDKKRAALNRLKTARGHLDGIIRMLESDAYCVDVMKQLSAVQSSLERANRVMLHNHLETCFSAAVLDGRGQAAIDELIDAVKFTPALTGPQAQLGGAVVCKPPGDQPAQSPA

12.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make csoR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here