carD

Beta-apo-4'-carotenal oxygenase

539 amino acids

Beta-apo-4'-carotenal oxygenase involved in the last step od synthesis of neurosporaxanthin, a carboxylic apocarotenoid acting as an essential protective pigments and leading to orange pigmentation. Is also able to use shorter apocarotenals as substrates (such as beta-apo-8'-carotenal (C30), beta-apo-10'-carotenal (C27), or the acyclic apocarotenal apo-8'-lycopenal (C30)), indicating wide substrate specificity.

Belongs to the aldehyde dehydrogenase family.

59.891 kDa

MAANNLSYTIAPLEHTPLDEIAAKVDLVRKTFRSGRTKDMEFRMKQIRKLYWAIVDNTELMQDALIKDLRKCKYEAVLAEIDWCKQECIDMVNNMEKWLRDEPVPNVPLQFRAMKHRTRFEPLGVVLNIGSFNFPFQLNLPVVIGAIACGNCVVLKASESSPNCAMVLKKIFDESLDPECFTYVNGALPETQLLLEQKFDKICFTGGKAVGKIIAQKAAETLTPVLLELGGLNPAFVTKHANLKLAARRLLWQKSLNAGQVCMSHNYILVERSVLSQFLGELNNQMRTFFPQGAKNSPDLCRIVNAGHFNRLKKMLDGTNGKIVLGGSMDESTLFMEPTAVLVDDINDSMMTQEAFGPIFAMMAVDSLDQAIDIANTVDPTPLSLSAFGSKAENNKILDNVTSGGATCNDAFFHSQIPQSPLGGVGQSGMGNYHGIYSIRTFSHQRTIAEVPYWADFLFRVRYMPYQWPVMNRMKAVADSKPNFDRNGNKTKGITYFLALVLGLGSKKSKGALLRWAVLVVAAAILEAKKGVLSQLLTR

carD

Carbapenem antibiotics biosynthesis protein CarD

376 amino acids

Belongs to the proline oxidase family.

42.885 kDa

MPNDLYAIYNRYTSRTLFFKYCATATLTHRLTRRLSLFTLKKCLARPQGRLFSLVNSIYFGGETLEEVQSTATFLARSGIACVLDYAVEGENDETQFDKAMENTLRLIEMSQQTDSLPFVVIKPSSLGSVAVYARQSERLALDEASASAWSRIVTRFSRLFDYARSHGVHVMVDAEQTAIQPAVDRLVLDMMREFNRDSAVITLTLQFYLKDQLRFLDECYQRACQDNFLFGVKVVRGAYLEEEKRVNGGVRCFATKQETDRSYNAAVDYIALRLDRIAPFFATHNEESLALIMSSESLRAGRTWVGQLYGLGDHITYSLLQTGFRVCKYLPYGPLDKSLPYLLRRIEENAVASATFKKENKLLQKELLRRLVGGM

carD

Caffeyl-CoA reductase-Etf complex subunit CarD

262 amino acids

Caffeyl-CoA reductase-Etf complex catalyzes the reduction of caffeyl-CoA to yield hydrocaffeyl-CoA. It couples the endergonic ferredoxin reduction with NADH as reductant to the exergonic reduction of caffeoyl-CoA with the same reductant. It uses the mechanism of electron bifurcation to overcome the steep energy barrier in ferredoxin reduction. The electron transfer flavoprotein (Etf) mediates the electron transfer between the different donors and acceptors. The complex can also reduce 4-coumaroyl-CoA and feruloyl-CoA.

Belongs to the ETF beta-subunit/FixA family.

28.237 kDa

MRILVCAKQVPDTNEVKIDPKTGTMIREGVPSILNPDDANALEAALVIKDENPGTEVIVMTMGPPQASEMLRECLAMGADEAYLLSDRAFGGADTWATSATLAAGIKKVKKVDLVLAGRQAIDGDTAQVGSQIAQRLKMPVVTYVEDIKIEDKKAIVHRQMEDGYEVIEVQLPCLLTCVKELNDPRYMSVGGIMDAYEQPITIWNHEDIGLSPEACGLNASPTQVFRSFSPPAKGGGEMITGTTVNEVAGSLVSKLKEKHII

carD

RNA polymerase-binding transcription factor CarD

162 amino acids

Controls rRNA transcription by binding to the RNA polymerase (RNAP). Required for the stringent response to starvation, oxidative and genotoxic stresses as well as control of rRNA under normal growth conditions.

Belongs to the CarD family.

17.934 kDa

MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKAETILDEVLAAAS

carD

RNA polymerase-binding transcription factor CarD

162 amino acids

Controls rRNA transcription by binding to the RNA polymerase (RNAP). Required for replication and persistence during infection of mice (By similarity).

Belongs to the CarD family.

17.907 kDa

MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS

carD

RNA polymerase-binding transcription factor CarD

162 amino acids

Controls rRNA transcription by binding to the RNA polymerase (RNAP). Required for replication and persistence during infection of mice.

Belongs to the CarD family.

17.907 kDa

MIFKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAAAS