Controls rRNA transcription by binding to the RNA polymerase (RNAP). Required for the stringent response to starvation, oxidative and genotoxic stresses as well as control of rRNA under normal growth conditions.

Belongs to the CarD family.

162 amino acids

MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLTVRVPADNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAENTDDAKAETILDEVLAAAS

17.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make carD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here