Caffeyl-CoA reductase-Etf complex catalyzes the reduction of caffeyl-CoA to yield hydrocaffeyl-CoA. It couples the endergonic ferredoxin reduction with NADH as reductant to the exergonic reduction of caffeoyl-CoA with the same reductant. It uses the mechanism of electron bifurcation to overcome the steep energy barrier in ferredoxin reduction. The electron transfer flavoprotein (Etf) mediates the electron transfer between the different donors and acceptors. The complex can also reduce 4-coumaroyl-CoA and feruloyl-CoA.

Belongs to the ETF beta-subunit/FixA family.

262 amino acids

MRILVCAKQVPDTNEVKIDPKTGTMIREGVPSILNPDDANALEAALVIKDENPGTEVIVMTMGPPQASEMLRECLAMGADEAYLLSDRAFGGADTWATSATLAAGIKKVKKVDLVLAGRQAIDGDTAQVGSQIAQRLKMPVVTYVEDIKIEDKKAIVHRQMEDGYEVIEVQLPCLLTCVKELNDPRYMSVGGIMDAYEQPITIWNHEDIGLSPEACGLNASPTQVFRSFSPPAKGGGEMITGTTVNEVAGSLVSKLKEKHII

28.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make carD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here