AAT

Aspartate aminotransferase

492 amino acids

Prokaryotic-type aspartate aminotransferase. Specific for aspartate and no activity with glutamine, asparagine, alanine, histidine, leucine, methionine, lysine, arginine, tryptophan, tyrosine, phenylalanine or kynureine.

Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

52.804 kDa

MMSASFKCPVSLSGVENICNGDKAIPGINSRTLFTGSSFLQRHHSANKIFFRTCGKKGSCCLFNIRAMAETDSGNGVPQLDISLSPRVAALKPSKTMAITDLATALKQAGVPVIGLAAGEPDFNTPDAVAEAGIKAIQDGYTRYTPNAGTMEIRTAICHKLKEENGLSYTPDQILVSNGAKQCIMAAAVLAVCSPGDEVIIPAPFWVSYTEMARLADATPVIIPTLLSDDFLLNPEVFSSKLNENSRLLILCSPSNPTGSVYPRELLEEIAKIVAKHPKLLVLSDEIYEHIMYPPAKHTSFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVTACGRIQSQSTSGASSISQKAGVAALALGYAGSEAVSTMVKAYRERRDFLVQRLQAMEGVKLPVPQGAFYLFPDFSSYYGTEVEDFGVINGSEALCRFFLEKAQVALVPGDAFGNDDCIRISYAASLDTLRTAINNIEKSLLLLRPAAAASKAS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

274 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

30.622 kDa

MSDFVNDGHTTPEAFVQHIKSLGRYDFPEPAIVDPEGMGIVAIGGDLAPETLISAYAQGLFPWFNDDEPIAWWCPEPRCVMQPTDYQPSKSLRKLANRSRWQLTLNQAFDEVIHACSLPRSNGVNNDLNESQPVGEHTWIHDEMIEAYTELHAQGFAHSIEVWDDKGALVGGLYGLKIGGIYFGESMFHIASNASKLAFWGLMRLCEHSNVNLVDCQLPNDHLMSLGAITLSRTEFLTQLDILISNSSDNWHKNSHKPLAVPLLGSLQPWQLNL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

268 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.894 kDa

MNNINDSSAIHITPETFVKQIRSLGRYNFPEPALVDPDGIGIVGIGGNLAPETLISAYAQGLFPWFNDDEPIAWWCPEPRCVMQPTDYQPSKSLRKQANNARWQLTLNQAFNEVIHACSLPRSNGLPEGEHTWIHDDMIEAYNELHAQGFAHSVEVWDDQGQLVGGLYGLKIGSIYFGESMFHIASNASKLAFWGLMRLCTQSNVTLVDCQLPNEHLMSLGAITLSRTEFLTQLDTLISNGSDAWHKNSHRPLAVSLLGNLQPWQLNP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

268 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.93 kDa

MTNMIDPHLLLSAYATGIFPMSDSRETDEVYWVEPKKRGILPPDHFHLSRSLAKIIRSDRFLVTADRDFEAVIDLCAEPTEDRPDSWINPPIRAAYCQLHNLGYAHSIECWLDNRLVGGLYGVNLGYAFFGESMFSRVSNASKVALAWLVARLKVGNFSLLDCQFITDHLASMGAIEITREDYLKRLKSAVSSYFTDKETGNWNTLDRLSPLLHNKHSKTKENQFADADLPFTEGIALETDGTAPGEASFSLACPNGARIVQLLGQIS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

265 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.244 kDa

MPTWLASPDDPLPDTRHALPAGSEVPGLVAAGTDLSPRRLAEAYARGIFPWYSAGQPVLWWSPDPRMVLPVAEFKLSHSLRKTLRRFSAAPHCEVRIDHDFAAVIHACATTPREGQDGTWIQPELQAAYTEWHRLGAVHSFETWVDGRLLGGLYGVNLGRMFFGESMFSHATDASKIALAALVAFCRANDIALIDCQQRTAHLGSLGAREIDRPAFEGHLARTVAQRPPEDWTYHRSHWTQLRLDTGPDPASSSVTEISLRPAAP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

263 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.853 kDa

MSRIEPHAIPPELLLKAYRAGIFPMADSRDDPEVFWVEPKMRAILPLEGFHLSRSLARTLRRGKFTVTCNAAFEAVIDACAAPRPGAEESWISARIRESYIGLHEHGHAHSIECWHNGRLVGGLYGVGFARVFCGESMFSREPDASKVALAWLVASLRKVGAELLDCQFTTPHLASLGAVEIPQSQYLQLLSKAQRPYSSGELAAARALADAVGDGLGIGGAGVVKGDAAALGLPAGFAALRAEGAGSSSPGNVIAQSLTHTS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

263 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.853 kDa

MSRIEPHAIPPELLLKAYRAGIFPMADSRDDPEVFWVEPKMRAILPLEGFHLSRSLARTLRRGKFTVTCNAAFEAVIDACAAPRPGAEESWISARIRESYIGLHEHGHAHSIECWHNGRLVGGLYGVGFARVFCGESMFSREPDASKVALAWLVASLRKVGAELLDCQFTTPHLASLGAVEIPQSQYLQLLSKAQRPYSSGELAAARALADAVGDGLGIGGAGVVKGDAAALGLPAGFAALRAEGAGSSSPGNVIAQSLTHTS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

261 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.462 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLIFHPRCSKDQPFKTPHIRLYPPLAGRLILLKW

aat

Leucyl/phenylalanyl-tRNA--protein transferase

259 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.817 kDa

MSQLQWLDADNLRFPPTHSALRDPDGLLAVGGDLSPARLIESYSHGIFPWYSDGQPLLWWTPDPRMVLRPAHVHRGRTLRKLLRQHPFTVTVDSAFDAVAQACGTIEREGQDGTWITQEMLAAYSELNRLGVAHSLEVWLQNELVGGLYGIALGTVFFGESMFSRVSGASKVGFSILCQQLENWGFELVDCQIHSGYLASFGAQEIPRATFEKLLAQHVWNIPRVPSAACYQSPIPTTSRPCPPLINWQMAWTAGEDLA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

258 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.891 kDa

MSARFGPEDLLACYRRGVFPMADSRDDPRLFLVDPDFRGILPLDAFHIPKRLKRRVCQDPYRVSFDTAFTRVVEACGEPHDNRPNTWINSPIVNLYSALHRQGFAHSVECWDGDQLVGGLYGVSLGGAFFGESMFSRATDASKIALVHLAARLIDRGYVLLDAQFHNPHLTQFGLIEISRDAFKARLKAALKVGADFHGGSDGPAPDQSIGMSSSGGVSDSVTPAGMSSYSGSSLSGMIARSGSFTGSGAVQRITQMS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

258 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.368 kDa

MYRLYWLDEHNPRSPFPPAEQAMDEPNGLLAVGGDLSPVRLEQAYRRGIFPWYGPGQPILWWSPDPRCIFRPGWLHVSRRLARRLRTGAFRMSLDTDFTGVISACAAPREDQAGTWIVPEMMHAYEALFELGIAHSVECWDRDGELVGGLYGVALSGAFFGESMFSRRSDASKACMAWLSAQLHRWGFALFDCQVSSPHLRRMGAVDVSRSRFLAQLQQALVLPHRRGPWRFDRDLDPVAIHRQHQTRTTAPEVLYGS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

256 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.868 kDa

MLPWLPAHRVAFPAVEHALREPDGLLAAGGDLTPAWLRCAYRHGIFPWFAPGEPILWWSPDPRLVLFPEEIHVRRSLAKRLRNAGFTVTFDHAFEAVITACATTRAAAEGTWITPAMHAAYYRLHIEGDAHSVEVWRDGELVGGLYGIALGGVFFGESMFSRVADASKVALVHLARHLAAHGGRLIDCQVHTPHLASLGARCIARTTFIDYLDQYVSAPVSSSLWPAAPSADGCTGASRHGPGADMRRGDMSREST

aat

Leucyl/phenylalanyl-tRNA--protein transferase

256 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

29.339 kDa

MSEPIHQPFWLDSKPVVFPPTHLAMTEPDGLLAVGGDLTPEWLLNAYHKGIFPWFNEDDPILWWTPNPRSVLFINSLKVRRSLIKTIRKQQFTVTLDQQFEDVMHQCANIERHDQDGTWISEEMLSAYTQLHKSGHAHSVEVWKDNQLVGGLYGVAIGKVFFGESMFSKVPDASKIALVALCQQLKAWGFRIIDTQMETAHLRSLGATLISREYFESILKQETHKDFAPKPWTLEVDWQAPFLAQPTIKKQKTTTP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

256 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.395 kDa

MIPWLPDDSDSAPFPPTRLALGPDSEAPGLLCAGGQLSVARLRMAYRLGIFPWYSQGQPVLWWSTDPRMVLQVAQFRLHRSLKKTLRRFLVTPGNEVRIDSAFADVIDHCSRTPREGQDGTWIVPEVKAAYVALHRAGSAHSFETWVDGELVGGLYGVNIGRMFYGESMFARRTDASKIALAALVAFCLAHEIAWIDCQMETEHLASLGAQPVPRAQFEAHLRRVVDLPAPKDWFYDPSSWARLGDRGPGQPSPSA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.205 kDa

MVPWLGPDDPFPSVERALGAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDCDFAGVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIPWRFDKRVVAGLLGQAASATAADAFDR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.235 kDa

MVPWLGPDDPFPSVERALGTASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDCDFAGVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIPWRFDKRVVAGLLGQAASATAADAFDR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.205 kDa

MVPWLGPDDPFPSVERALGAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDCDFAGVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGRMFFGESMYAHASDASKIALAALVAHLREHRVEMIDCQQNTSHLASLGGREIARKTFVAHVRRAVAEPPIPWRFDKRVVAGLLGQAASATAADAFDR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.987 kDa

MVPWLGPDDPFPSVERALGAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILVPAEFRISATFRKTLKRVLREPRWEIRVDCDFAGVMRACAQAPRRGQRGTWITAEIIDAYSSLHRAGDAHSIETWLDGRRVGGLYGVSFGGMFFGESMYADVSDASKIALAALVAHLREHRVVMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPISWRFDKTVVAGLLGQAASATAADAFDR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.528 kDa

MGKLPRPVPWLAAGENFPPLEFAWGRHDPAPGLLAAGAALDVPTLIQAYSRGIFPWFSLGQPVLWWSPDPRMVLHTEKFKLHRSLRKSLIHFLDDPECEIKFDSAFEHVIKACASQPRAGQPGTWIVPDMVQAYSSLHRAGYAHSVETWVRGKLVGGLYCVKLGRMVFGESMFAHQTDASKIALAALVGFCRAHQIAMIDCQQNTRHLASLGAAEIDRADFVRHLAQNVEKTTPPWQFEPVYWKQILTAEKPTLP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

255 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.528 kDa

MGKLPRPVPWLAAGENFPPLEFAWGRHDPAPGLLAAGAALDVPTLIQAYSRGIFPWFSLGQPVLWWSPDPRMVLHTEKFKLHRSLRKSLIHFLDDPECEIKFDSAFEHVIKACASQPRAGQPGTWIVPDMVQAYSSLHRAGYAHSVETWVRGKLVGGLYCVKLGRMVFGESMFAHQTDASKIALAALVGFCRAHQIAMIDCQQNTRHLASLGAAEIDRADFVRHLAQNVEKTTPPWQFEPVYWKQILTAEKPTLP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.03 kDa

MVPWLGPDDPFPSIERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRAPEWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVTDASKIALAALIAHLREQRLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPWQFDKRVLAALTSPAETAAPTGTER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.931 kDa

MVPWLGPDDPFPSIERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRAPEWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVTDASKIALAALIAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPWQFDKRVLAALTSPAETAAPTGTER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.03 kDa

MVPWLGPDDPFPSIERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLRAPEWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVTDASKIALAALIAHLREQRLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPWQFDKRVLAALTSPAETAAPTGTER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.003 kDa

MVPWLGPDDPFPSIERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLREPDWEVRVDHDFPGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADVTDASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPWQFDKRVLAALTSPAETAAPSGTER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.96 kDa

MVPWLGPDDPFPPVERALGPATGAPGLLAASADLLPSRLIEAYLRGIFPWYSDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLRRVLREPAWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRIGGLYGVAFGRMFFGESMYADATDASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPWQFDKRVLAALTGPAEPAAPSGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.01 kDa

MVPWLGPDDPFPPIERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPAEFKVSPSLRKTLKRVLREPEWEVRVDHDFPGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRVGGLYGVSFGRMFFGESMYADATDASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRSAVAEPPIPWQFDKRVLAALTGRAEAAAPSGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.073 kDa

MVPWLGPDDPFPPVERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILVPDEFKVSPSLKKTLKRVLRDPAWEVRVDHDFRGVMRACAQAPRRGQRGTWITAEIIDAYSSLYRSGNAHSIETWHDGRRVGGLYGVAFGQMFFGESMYADVTDASKIALAALVAHLREHGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPWQFDKRVLAALTGRTEPAAPSGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.796 kDa

MVPWLDPNDPFPPVERALGPATGAPGLLAASADLLPSRLIDAYLRGIFPWYSDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLKRVLRDAAWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLHRSGNAHSIETWHDGRRVGGLYGVAFGRMFFGESMYADATDASKIALATLVAHLRDQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAAAEPPIPWQFDKRALAALTGPAGAAAPRGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.886 kDa

MSSQPPPLPWLDPNQDFPPTSQAWDENSPAPGLLAAGGVLDVETLRRAYSQGIFPWYSEGQPTLWWSPNPRMVLQVANFRLRPSFKKKIRQFCQTPGCEIRIDSAFEQVIEACASSARIGQSGTWIVPDMRAAYGELHRVGLAHSVETWVNGELAGGLYCVALGKAVFGESMFSRVSDASKIALAALIGFCRHHGVKQIDCQQNTPHLASLGAGEISRDLFLKGLAAGLAEAGPAWEFDRRFWQQLLTPESMST

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.097 kDa

MKLPWLAADTPFPPVEQALRDPDGLLAAGADLSPERLAQAYAHGIFPWYAEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHECAAPRHGQPGTWISPAVQQAYRSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMFARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPRLPWRSGRLDSAGMLHPLPPANGVMM

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.078 kDa

MKLPWLAADTPFPPVEQALRDPDGLLAAGADLSPERLAQAYAHGIFPWYAEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHECAAPRHGQPGTWISPAVQQAYHSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMFARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPRLPWRSGRLDSAGMLHPLPPANGVMM

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.96 kDa

MVPWLGPDDPFPPVERALGPATGAPGLLAASADLLPSRLIEAYLRGIFPWYSDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLRRVLREPAWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRIGGLYGVAFGRMFFGESMYADATDASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPWQFDKRVLAALTGPAEPAAPSGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.097 kDa

MKLPWLAADTPFPPVEQALRDPDGLLAAGADLSPERLAQAYAHGIFPWYAEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHECAAPRHGQPGTWISPAVQQAYRSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMFARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPRLPWRSGRLDSAGMLHPLPPANGVMM

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.078 kDa

MKLPWLAADTPFPPVEQALRDPDGLLAAGADLSPERLAQAYAHGIFPWYAEGEPILWWSPDPRMVLACADFAPSHSLRKRLRALARTEHDPAARLQVRVDTAFARVLHECAAPRHGQPGTWISPAVQQAYHSWHAAGFVHSIETWIDGELAGGLYGVSLGRMFYGESMFARATDASKIALAHLVAFLRRHQVAWIDCQQQTGHLARLGARPVPRARFIEHIAHAVAQPRLPWRSGRLDSAGMLHPLPPANGVMM

aat

Leucyl/phenylalanyl-tRNA--protein transferase

254 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.96 kDa

MVPWLGPDDPFPPVERALGPATGAPGLLAASADLLPSRLIEAYLRGIFPWYSDGQPVLWWSPDPRMILAPAEFKVSPSLRKTLRRVLREPAWEVRVDHDFAGVMRACAQAPRRGQRGTWITAEIIDAYTSLYRSGNAHSIETWHDGRRIGGLYGVAFGRMFFGESMYADATDASKIALATLVAHLREQGLEMIDCQQNTSHLASLGGREIARKAFVAHVRRAVAEPPIPWQFDKRVLAALTGPAEPAAPSGIER

aat

Leucyl/phenylalanyl-tRNA--protein transferase

253 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.709 kDa

MKLPWLSPDTPFPPVEHALSDPAGLLAAGADLSLERLTAAYSNGIFPWYSEGEPILWWSPDPRMVLACADFAPSHSLRKLLRQIAREESALLPRVQVRVDTEFDAVVAQCAAPRDGQAGTWITADMQQAYRAWHAAGVAHSVETWIDGELAGGLYGISLGRMFFGESMFTRVPDASKVALAYLVAFLRRAGVEWIDCQQQTRHLASLGARPVPRARFVEHIRQAIAGPAPAWQSGRLDSQGSLHPAPVSTLLY

aat

Leucyl/phenylalanyl-tRNA--protein transferase

253 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.709 kDa

MKLPWLSPDTPFPPVEHALSDPAGLLAAGADLSLERLTAAYSNGIFPWYSEGEPILWWSPDPRMVLACADFAPSHSLRKLLRQIAREESALLPRVQVRVDTEFDAVVAQCAAPRDGQAGTWITADMQQAYRAWHAAGVAHSVETWIDGELAGGLYGISLGRMFFGESMFTRVPDASKVALAYLVAFLRRAGVEWIDCQQQTRHLASLGARPVPRARFVEHIRQAIAGPAPAWQSGRLDSQGSLHPAPVSTLLY

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.503 kDa

MIAWLDPQDPFPPVDEALGPDSEAPGLLAASRDLSPQRLLLAYRQGIFPWYSSGQPVLWWSTDPRMVLAPPALRVSLNLRKTLRRVLRDADWEIRVDDDFLAVMRACATTPRDGQDGTWITDDIIAAYGTLHRNGMAHSVESWYRGERVGGLYGVALGRMFFGESMFAHRTDASKIALAALCAFLGNHGVAMIDCQQETDHLASLGARPIPRAEFVAHVRAATALPAISPWRFDKSVLERWAGTPAAPAG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.751 kDa

MIAWLDPHDPFPPVERALGPATEAPGLLAASRDLSPQRLLLAYRQGIFPWYSVGQPVLWWSTDPRMVLAPQALKISATFRKTLRRVLRDPDWEIRVDDDFLAVMRACAMTPREGQDGTWITREIIAAYGALHSNGMAHSVETWYRGTRVGGLYGVALGRMFYGESMFAHRTDASKIALAALCAFLGSHGVPMIDCQQETDHLASLGARPIARAEFLAHVRNASAQPAITPWWFDKSVLERWTATPATPAV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.484 kDa

MIAWLDPQDPFPPVEHALGPDSEAPGLLAASRELSPQRLLLAYRQGIFPWYSSGQPVLWWSTDPRMVLAPPALRVSVNLRKTLRRVLRDADWEIRVDHDFLAVMRACASTPREGQDGTWITDAIIAAYGALHRNGLAHSVESWYRGERVGGLYGVALGRMFFGESMFAHRTDASKIALAALCAFLGNHGVAMIDCQQETDHLASLGARPIPRAEFVAHVRAATAQPAISPWRFDKSVLERWAGTPAAPAA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.685 kDa

MRIPWLEADTPFPPAEQALKEPNGLLAAGGELNTDRLRAAYAKGIFPWYSEGEPLLWWSPDPRMVLACADFAPSHSLRKTLRRLARAEQAGDTRIQVRVDTAFARVMAACAGRRDGQAGTWITPEVQAAYCAWHEQGQAHSIETWIDDHLVGGLYGISLGGMFFGESMFAHATDASKIALAYLVAFLTRHEVDWIDCQQQTRHLASLGARPLPRAQFLQHVARVLAKPAPPWRVGVLRHAGDIVDSANQR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.685 kDa

MRIPWLEADTPFPPAEQALKEPNGLLAAGGELNTDRLRAAYAKGIFPWYSEGEPLLWWSPDPRMVLACADFAPSHSLRKTLRRLARAEQAGDTRIQVRVDTAFARVMAACAGRRDGQAGTWITPEVQAAYCAWHEQGQAHSIETWIDDHLVGGLYGISLGGMFFGESMFAHATDASKIALAYLVAFLTRHEVDWIDCQQQTRHLASLGARPLPRAQFLQHVARVLAKPAPPWRVGVLRHAGDIVDSANQR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.13 kDa

MTPFRRPTVLGTSASAPFPPAEAALTDPDGLLAVGGDLSPQRLLNAYAHGIFPWYSEGQPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACAASPRPGQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAIGRMFFGESMFSGESGGSKVALAALAANLHGRGWPLIDAQVENPHLLSLGAERLPRADFLHQVQRQVALTEPPGSWSARYGEHAASGLCETRLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.273 kDa

MTPFRRPIVLATSASAPFPPAEAALTDPDGLLAVGGDLSPQRLLNAYAHGIFPWYSDGRPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACAASPRPGQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAVGRMFFGESMFSGESGGSKVALAALAADLHGRGWPLIDAQVENPHLLSMGAERLPRAEFLHDVQRQVALAEQPGSWSQRYGEHAASDLCETHLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

250 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.273 kDa

MTPFRRPIVLATSASAPFPPAEAALTDPDGLLAVGGDLSPQRLLNAYAHGIFPWYSDGRPILWWSPDPRMVFRTDGVRLSSRFKRQLRASTWTVRADTAFEQVIDACAASPRPGQDGTWITAEMQQAYIALHRLGHAHSIEVFDGARLVGGIYGVAVGRMFFGESMFSGESGGSKVALAALAADLHGRGWPLIDAQVENPHLLSMGAERLPRAEFLHDVQRQVALAEQPGSWSQRYGEHAASDLCETHLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

249 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.028 kDa

MITWLDPQDPFPPVERALGPASDAPGLLAASRDLSPQRLLLAYRQGIFPWYSEGQPVLWWSTDPRMVLAPHRLKISVSLRKTLRRILRDPDWEIRVDDDFVAVMQACAMTPRDGQLGTWITDDIVAAYGSLHRLGLAHSVETWYRGERVGGLYGVALGRMFYGESMFAHRTDASKIALAALCGFLERHGVTMIDCQQETDHLASLGAEPIPREQFIAHVRQTAAEANISPWRFDKSELTRWTSQASTEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

249 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.301 kDa

MARHLPFLLDADPTAPFPPAAQALRDPDGLLAIGGDLAPQRLLNAYAHGIFPWFSQDQPILWWSPDPRMVFRTDALRLSSRFRRQLRSSSWTVRADTAFEQVIDACASVPRAGQDGTWITAQMQQAYIALHELGHAHSLEVFDGTRLVGGIYGVAIGQMFFGESMFSAQSGGSKVALAALAMHLHTEGWPLLDAQVENPHLLSLGAQRLPRAQFLQQVQLQVARPALPGTWSGRYGQRPASSLGEARLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

249 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.404 kDa

MSRTLPHLLSSDPASPFPPAEHALREPDGLLAIGGDLHPQRLLNAYAHGIFPWFSDGQPLLWWSPNPRTVFRTDAIHLSSRFRRQLRTCTWTLRADTAFAQVIAACALSPRPGQDGTWITDQMQEAYLDLHRRGYAHSVEVFDGARLVGGIYGVAIGQMFFGESMFSGASGGSKIALAALAAELHGLGWPLIDAQVENPHLMRLGAQRLQREQFLQHVATQVALPEPPGSWTQRYGERHASALAGVRLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

249 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.335 kDa

MSRTLPHLLSPDPASPFPPAERALREPDGLLAIGGDLHPQRLLNAYAHGIFPWFSDGQPLLWWSPNPRTVFRTDAIHLSSRFRRQLRTCTWTLRADTAFAQVIAACASSPRPGQDGTWITDQMQEAYLDLHRRGYAHSVEVFDGARLVGGIYGVAIGQMFFGESMFSGASGGSKIALAALAAKLHGLGWPLIDAQVENAHLMRLGAQRLPREQFLQHVATQVALPEPPGSWTQRYGERHASGLAGVRLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

249 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.404 kDa

MSRTLPHLLSSDPASPFPPAEHALREPDGLLAIGGDLHPQRLLNAYAHGIFPWFSDGQPLLWWSPNPRTVFRTDAIHLSSRFRRQLRTCTWTLRADTAFAQVIAACALSPRPGQDGTWITDQMQEAYLDLHRRGYAHSVEVFDGARLVGGIYGVAIGQMFFGESMFSGASGGSKIALAALAAELHGLGWPLIDAQVENPHLMRLGAQRLQREQFLQHVATQVALPEPPGSWTQRYGERHASALAGVRLT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

248 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.65 kDa

MIAWLDPHDPFPPVDRALGPESEAPGLLAASAELSPQRLLIAYRQGIFPWYAQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPAWEIRIDHAFRETMVACATTARPGQHGTWITEDVIQAYTALHRRGYAHSVETWHAGQRVGGLYGVALGRMFYGESMFAHRTDASKIALAALCAFLGGQGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAIVPWHFDKSVLRRWTVRNEQA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

248 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.705 kDa

MIAWLDPHDPFPPVDRALGPDSEAPGLLAASADLSPQRLLIAYRQGIFPWYAQGQPVLWWSTDPRMVLRPEDFRVSTTFRKTLRRVLDDPTWEIRIDHAFRDVMVDCATTARPGQHGTWITEDVIQAYTALHRRGYAHSVETWHGGRRVGGLYGVALGHMFYGESMFAHRTDASKIALAALCAFLGSRGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAIVPWHFDKSVLRRWTARNEQA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

248 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.351 kDa

MKAIDPDLLLRAYSIGVFPMADSRAADDVYWVEPKKRGILPLDHFRLSRSLAKTIRSDRFAVTADRAFGEVVAECAAVTSQRPDTWINPAIEAAYADLHRRGHAHSIECWREGRLVGGLYGVRLGGAFFGESMFSRESNASKVALAWLVARLRAGGFRLLDCQFITDHLQSLGAIEVSRDDYVALLDVALGVVAGAGAAGGVAVAGAAAGWSAPDFFALDGGATDPDTRTVSGPISGCTIVQLLGQTS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

248 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.736 kDa

MHLYALSEKLEFPDPQTASSEGLLAIGGDLSVARLVTAYANGIFPWYDDDTPILWWSPDPRCVLYPSQLHVPASLRRRINSGQFEVTLDTAFEAVIHACADAARPGQSGTWIVDEMIDAYMNLHEAGVAHSVEVWSRGAGDGRVLAGGLYGVALGGVFYGESMFYRRTDASKVAVVWLVRLLEFWGYRVVDCQQTTTHMLRFGAQEVSRACFLEELDRALRMPLRAGRWQIPDGFRPLRRATLPDENQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

247 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.011 kDa

MRRLRWLNEHVPDEPFPAADQALADPNGLLAVGGDLSPERLMSAYRNGIFPWYGEGQPILWWSPDPRGVFLPGDFRISRSLRRRLNQTRMQVTLDTEFEAVVAGCAAPRPDQDGTWITREMIAAYTELHLQGCAHSAEVWLDGELVGGVYGVALNGAFFGESMFSRMEDASKVGLTWLTAQLWRWGFALFDCQMSNPHLARLGVREIPRSEYLRRLEPALRAPHRPPPWTLEAELDPVSEHRHREGP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

247 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.38 kDa

MPVFALIDEPVFPSPHLAEPGGLLAVGGDLSVARLLAAYRRGIFPWYDDESPILWWSPDPRPILVPGHVRVSKRLERTIRSGKFTVTLDTDFAGVIRGCAAVPRDADNGTWIVPDMIEGYERLHAAGHAHSVEAWQNGELVGGAYGVAIGKAFFGESMFHRATDASKVAFVTLCRFLDRHEFRFIDCQQATGHLLRFGAVQVRRNEFLRRLEAAREEEGMVGKWVLPRTTRCASPQPTSESSPSAKQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.353 kDa

MVPWLGPDDPFPPVERALSAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWTPDPRMILRPREFKISPSLKKTLRRVLRDDTWEIRVDADFPAVMRACALAPRHGQRGTWITSDVIDAYSTLHRRGEAHSIETWHAGKRVGGLYGVSFGKMFFGESMYAEVTDASKIALSALVFHLRRHEIEMIDCQQNTSHLASLGGREIARKAFVAHVRAAVDSAPIPWSFDKSVLRDLLAPAQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.218 kDa

MVPWLGPDDPFPPVERALGATSGAPGLLAASGDLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMVLRPAEFKVAPSLRKTLRRVLREDAWEIRVDHDFASVMRACAQAPRRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGKRVGGLYGVSFGKMFFGESMFAEVTDASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREITRKSFIAHVRASVEAPPIPWRFDKTALLEVVAPAS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.196 kDa

MVPWLGPDDPFPPVERALGANSGAPGLLAASGDLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLRRVLRDDAWEIRVDHDFAAVMRACAQAPRRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGRRVGGLYGVSFGKMFFGESMFAEVTDASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVEAPPIPWLFDKTVLLEIVAPAA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.353 kDa

MVPWLGPDDPFPPVERALSAASGAPGLLAASADLLPSRLIDAYRRGIFPWYSDGQPVLWWTPDPRMILRPREFKISPSLKKTLRRVLRDDTWEIRVDADFPAVMRACALAPRHGQRGTWITSDVIDAYSTLHRRGEAHSIETWHAGKRVGGLYGVSFGKMFFGESMYAEVTDASKIALSALVFHLRRHEIEMIDCQQNTSHLASLGGREIARKAFVAHVRAAVDSAPIPWSFDKSVLRDLLAPAQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.218 kDa

MVPWLGPDDPFPPVERALGATSGAPGLLAASGDLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMVLRPAEFKVAPSLRKTLRRVLREDAWEIRVDHDFASVMRACAQAPRRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGKRVGGLYGVSFGKMFFGESMFAEVTDASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREITRKSFIAHVRASVEAPPIPWRFDKTALLEVVAPAS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

245 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.196 kDa

MVPWLGPDDPFPPVERALGANSGAPGLLAASGDLLPSRLIDAYRRGIFPWYSDGQPVLWWSPDPRMILRPAEFKVSPSLRKTLRRVLRDDAWEIRVDHDFAAVMRACAQAPRRGQRGTWITADVVEAYSSLHRVGDAHSIETWFEGRRVGGLYGVSFGKMFFGESMFAEVTDASKMALAALVGHLRRHEIEMIDCQQNTSHLASLGGREIARKAFIAHVRASVEAPPIPWLFDKTVLLEIVAPAA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

244 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.046 kDa

MIPWLEADDPFPHVSSALTEADGAAGLLAAGADLSTGRLLQAYKHGIFPWFSEGQPILWWSTDPRMVLFVENFRISASLKKKLKKIHHSITSRDGQWEIRFDHAFEEVMRACAAPRNGEGGTWISDEIIAGYTGLHKLGYAHSSELWLQGKLVGAAYGVSIGQMFYGESMFARVPDASKIALAYLVHFLRNHDVSMIDCQQETSHLATLGAAPIARTEFISRLRQAVSGPQISNWQPIALFPHD

aat

Leucyl/phenylalanyl-tRNA--protein transferase

244 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

28.236 kDa

MTAYLLHDELIFPHPEYADPDGLLAIGGDLSPDRLILAYKSGIFPWYNHKPILWWSPSKRPLIFPRLFKMSRSLYQTLKKDIYRVSFDKDFVTVIKGCATAPRKDSTGTWITEEMIEAYTLLHKLGFAHSVEVWFNDKIVGGLYGISIGRAFFGESMFTLMKDASKVAISCLVEHLILNNFYFIDCQITNKHLIRLGAYEIPRSVFLILLKEAVQKETLTNKWDRDFEFTSKTAKFLKEKLIPR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

244 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.528 kDa

MHSQPYLLSPAPNNTPFPPAEHALREPNGLLAIGGDLTPQRLLAAYRSGIFPWFTEGQPPLWWSPDPRTVFHSDSIHLSRRFRRSLRTSTWRVRADTMFAAVIDACASTPRRGQDGTWITANMREAYLTLHQHGYAHSVEVFDGTMLVGGIYGVAIGRMFFGESMFSTHNGASKIALASLAYFLHTHSVPLIDAQVENQHLLNLGAERWPRRDFLTYVRRLITQTELPACWSVLFGEKLSRDLV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.031 kDa

MIPWLEADDPFPNVSSALTEADGAPGLLAAGADLSAERLLLAYQNGIFPWFSEGQPILWWSTDPRMVLFIQDFKISASLKKTLKKIDRSMIANGRWQIRFDHAFEDVMRACAAPRNGEAGTWISDDIIAGYTRLHRLGYAHSSELWLDDELVGGLYGVSIGNMFYGESMFTRVTDASKIALAYLVRFLGSHGVSMIDCQQQTAHLASLGAMPISRTEFISLLRQAIAAPQIMDWKPIPMFEVN

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.321 kDa

MHSQPYLLSPTPNTPFPPAEHALHEPNGLLAIGGDLTPQRLLAAYRSGIFPWFTEGQPPLWWSPDPRTVFHSDNIHLSRRFRRSLRTSTWTVRADTMFAAVIDACASTPRRGQDGTWITANMREAYLTLHQHGYAHSVEVFDGTMLVGGIYGVAIGRMFFGESMFSTHNGASKIALASLAYFLHTHSVPLIDAQVENQHLLNLGAERWPRRDFLTSVRRLITQTELPACWSVLFGEKLSRDLV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.583 kDa

MTIYLTELSPETLTFPSPFTALDDPNGLLAFGGDLRPERIWAAYQQGIFPWYGPEDPILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCALTRPADQRWLNDSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYFCDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSLLSFKEKQVLSGCFETQWLATPTSPCAFED

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.569 kDa

MAIYLTELSPETLTFPSPFTALDDPNGLLAFGGDLRLERIWAAYQQGIFPWYGPEDPILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCALTRPADQRWLNDSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYFCDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSLLSFKEKQVLSGCFETQWLATPTSPCAFED

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.569 kDa

MAIYLTELSPETLTFPSPFTALDDPNGLLAFGGDLRLERIWAAYQQGIFPWYGPEDPILWWSPSPRAVFDPTRFQPAKSVKKFQRKHQYRVSVNHATSQVIEQCALTRPADQRWLNDSMRHAYGELAKQGRCHSVEVWQGEQLVGGLYGISVGQLFCGESMFSLATNASKIALWYFCDHFSRHQGQLIDCQVMNPHLQSLGATTLSREQFIQSLLSFKEKQVLSGCFETQWLATPTSPCAFED

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.321 kDa

MHSQPYLLSPTPNTPFPPAEHALHEPNGLLAIGGDLTPQRLLAAYRSGIFPWFTEGQPPLWWSPDPRTVFHSDNIHLSRRFRRSLRTSTWTVRADTMFAAVIDACASTPRRGQDGTWITANMREAYLTLHQHGYAHSVEVFDGTMLVGGIYGVAIGRMFFGESMFSTHNGASKIALASLAYFLHTHSVPLIDAQVENQHLLNLGAERWPRRDFLTSVRRLITQTELPACWSVLFGEKLSRDLV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.364 kDa

MHSPPYLLSPAPNTPFPPAEYALREPNGLLAIGGDLTPQRLLAAYRNGIFPWFTEGQPPLWWSPDPRTVFRSDSIHLSRRFRRNLRTSTWTVRADTMFAAVIDACASTPRRGQDGTWITANMREAYLTLHQHSYAHSVEVFDGTMLVGGIYGVALGRMFFGESMFSTRNGASKIALASLAHFLHTHSAPLIDAQVENQHLLNLGAERWPRKDFLAYVRRLITQTDLPACWSVLFGEQLSRELV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

243 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.175 kDa

MPELVWLNPHDTVFPPTTSALEDPNGLLAVGGDLSPARLIAAYKKGIFPWFDDSQPILWWSPDPRMVLLPQNLHLGKTLKKLAKKQAFKITIDTHFSDVMQGCAQPRADQDGTWITTDMENAYLELHKLGYAHSIEAWQDGELVGGLYGIAINRVFYGESMFSKVSGASKIAFANLATQLASWGFYAIDCQVATEYLASFGAAEMPRVEFEQILQQSLQSQPPKCQIEGWQNSWNMPDYGQLF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

242 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.261 kDa

MVPWLEPGEPFPDTRLALTDPDGLLAAGSDLSPDTLLRAYSTGIFPWYDAESQPILWWSPAPRCVIQLEQLHVSRSLARHLRRADFTVTFDRAFETVMRTCAAPRQDEAGTWISEDMLAAYCRLHELGYAHSVEIWQNGALAGCLYGIQLGQMFFGESMASPQRNGSKVALVALRNFARKLDIQLLDAQIENPHLMSMGAEMMPRSAFEAHLQRWIPSQPAPSHWPGDRFDWPDLQAAHQAF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

242 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.928 kDa

MRIMQLDRHSLGFPSPEQALHDPNGLLAIGGDLQPARLLQAYQRGIFPWFSPGELILWWSPDPRAVLVPQALHISHSLRKALRRTTLRITLNQAFAAVIAGCAEQRAEGTWIGPSIQQAYCQLHQLGHAHSVEVWQEERLVGGLYGVAQGSLFCGESMFSRVSNASKMALWSFCSHFQRMGGQLIDCQVLNAHTASLGAHDIPRRRYLQHLLNCRSQTLAPRCWLPQSLTLPLPATATQIGE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.324 kDa

MGQILYQLDDNSLTFPLIECALTEPNGLLALGGDLSPERLIAAYSQGIFPWYSDNDPLMWWSPNPRAIIDIDQLRINRTLRKAINKSPYQITLNQDFSQVTQLCANAPFRTDGTWILPEMEAAYLTLHQQGYAHSIEVWYTDEHDNKALVGGLYGVAVNGFFSGESMFYKQSNASKFALIALGQLLKSVDINFIDCQLLNPFLEDMGAKETSRDIFIHKQQHALTKTMPDDFWQPRTLTVI

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.699 kDa

MILPSMYVFPDPPEADPEGQGLICIGADLEPSTLFEAYTHGLFPWFNEGDPICWWSPEPRCVIYPEQYQPSKTLIRSMKKYDYQITMNRAFEKVIRSCALPRNYTNETWISEDIVQGYVELFKAGYAYSVEVWENDQLIGGLYGVNIGKGCFGESMFSLRTDTSKIAFYTLMLIGQENQVPWVDCQLVNDHLISLGACTLSRQAYLKSLQDVIIQPPINWKRYQERVFSSKRIAQNAKLTE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.901 kDa

MRIPLLAPDNYAFPDPAYALARCDGLVGVSRDLDAGRLLEAYRNGVFPWFSRDGWFFWYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAPEFQTAYLKLHEMGHAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACKGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.901 kDa

MRIPLLAPDNYAFPDPAYALARCDGLVGVSRDLDAGRLLEAYRNGVFPWFSRDGWFFWYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAPEFQTAYLKLHEMGHAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACKGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.834 kDa

MRIPLLAPDNYAFPDPAYALAWCDGLVGVSGDLDAGRLLEAYRNGVFPWFSRDGWFFWYAVGPRAVIVPERLHVPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAPEFQTAYLKLHEMGHAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVVCKGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.831 kDa

MRIPLLAPDNYAFPDPAYALAWCDGLVGVSGDLDAGRLLEAYQNGVFPWFLRDGWFFWYAVGPRAVIVPERLHVPCSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACRGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.836 kDa

MRIPLLAPDNYAFPDPAYALARCDGLVGVSGDLDAGRLLEAYRNGVFPWFSRDGWFFWYAVGPRAVVFPDRLHIPRSLAKTLRNGSYRVAVNGCFAEVVAHCAAAARPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDESGETRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLADLGVELIDCQQDTEHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACKGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.015 kDa

MRIPLLAPDNYAFPDPAYALARCDGLVGVSRDLDAGRLLEAYRNGVFPWFLRDGWFFWYAVGPRAVIVPERLHVPRSLEKTLRNCSYRVTVNGCFAEVVAHCAAAVRPNQDGTWIAPEFQTAYLKLHEMGYAHSFECHYPDENGKTRLAGGFYGVQIGRVFYGESMFALQPDASKIAFACAVPFLASLGVELIDCQQDTGHMRRFGSELLPFADFAERLRMLNAVPLKEEIGRREVACKGL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

241 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.719 kDa

MRIVKLSPHSLAFPSPEGALRDPNGLLAIGGDLTAPRLLAAYERGIFPWFSPGEAILWWSPDPRAVLFPAERHISRSLKRFLRSNPFRVTLNHDFAAVIAACADRPEEGTWIGPEVQRAYLHLHRLGFAHSIEVWQGDELVGGMYGVAQGALFCGESMFSRTTNASKCALMTFCRHFAAYGGELIDCQVLNAHTATLGAKEIPRRQFLQQLSQLQRKPLAPECWAPQVLPPQQVEPPSPTN

aat

Leucyl/phenylalanyl-tRNA--protein transferase

240 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.673 kDa

MVVYRLIEDPIFPHPDEAEPDGLLAVGGDLSPERLLSAYASGIFPWYDERSPILWWSLDPRLILNFDKLHVSRRVKRKVRKREYTVTFDRAFESVIANCARKFRPGQAGTWILPEMIEAYVKLHKLGFVHSVEVWNREGNLAGGLYGVSLGKVFSGESMFFLEPDASKVGFSYLVQWLKNREFHFVDCQQPTDHLKSLGAEEVSRELFLDMLDEALEHPALRGTWEFMEGEYEMITEVLS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

240 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.746 kDa

MEEFHCIDSNRLANAFPHPRLALAEPNGLLAVGGDLSPERLIMAYRQGIFPWYNQGQPILWWSPDPRLILFPQQLHISRSLHKRLRRGIYQVTLDLDFPGVIQACASPRQDGEGTWITSEMKSAYNRLHEMGIAHSVETWEDKELIGGLYGVSIGRIFFGESMFSKRPDASKIAFVYLCRQLQRWGFPLIDCQIQSEHLQRLGAQTLPRNKFLHWLHEFSNSPSLKRPWHFDPDLLKNSL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

239 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.102 kDa

MTIYLPELIPSHSTVFPDIENALNNPDGLLIMGGDLSSKQLISAYQHGIFPWYSNGDPILWWSPSVRGVFFPEQFSPSKSLKKFFRKSNYNVTLNKATYQVIDLCASTRPKEETWIMPEMINAYKKLANLGYCHSVEVWNEDELIGGLYGLQIGQIFCGESMFSLQTNASKIALWKFCEHFVSFNGKLIDCQMMNPHLESLGAKEMKRCDFKTLLEELSTKSTIANCYLPQILGDNSLS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

239 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.916 kDa

MTIYLPELIPSHSTVFPNIENALNNPDGLLIMGGDLSSAQLISAYQHGIFPWYSDGDPILWWSPSVRGVFFPEQFSPSKSLKKFFRKSNYNVTLNKATYQVIDLCASTRPKEETWIMPEMIKAYKTLVDLGYCHSVEVWNDNELIGGLYGLQIGQVFCGESMFSLQTNASKIALWKFCEHFVSSNGKLIDCQMMNPHLESLGAQEMKRSDFKTLLEELHVKPTSSDCYLAQTLGGSSFS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

239 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.019 kDa

MPICPLGKVIVFPPVSLAMEDGLLAVGGDLSPYRLLEAYRQGIFPWYSPGEPILWWAPQPRFVLFPDEILLSRSMRQILRKKHFQVTLDRNFDAVIHACATIGRPAQEGTWITEEMQEAYSILHELGYAHSVEVWRDRGLIGGLYGVSLGGCFFGESMFSRESNASKAALIFLSSLLKILRFTLIDCQVYTSHLALLGARFIPRETFTALIRKSLRRPTLRGNWSTHPETADKLPGHEF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

238 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.844 kDa

MKKQLYQLSNTDIAFPPIECALDSPDGLLAIGGDLSLARLSNAYNNGIFPWFSEDEPIMWWSPSERGIVELDNFHISKSLRKHLKKHPVTVTINNAFIEVIEACCEQRIDTDGTWITSDMLTAYINAHNAGIAHSVEVWREGELAGGLYGIMQNGVFCGESMFHHQTNCSKLAMWALVNWLKRHNAHFIDCQLENPYLMSLGATVIPRPAFLAKLHAAQNYKVDPAMWIPQELNAIYE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

238 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.072 kDa

MTLYIPELPINNTIFPDTSLALSDPDGLLAMGGDLSPQRIIKAYQQGIFPWFSDGQPILWWSPSQRAIIQPNLVHISSSMKKIISKNNFSLSINHAFHDVIDACAAPRGNQNETWITFDMIAAYQKLHQQGIAHSIEVWRDNKLVGGLYGVCIGSVFCGESMFSKEDNTSKIAFIALCQHFDKFKGQLIDCQILTKHLQSFGVQNESRDNFINYLNQYKNININKKCWDKQTIFIKNR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.326 kDa

MIPWLAGRPDFPPVEQALEDPDGLLAAGGELSPAWLLAAYRRGIFPWYTEDQPILWWSPDPRLVLIPAHLRISRSLRRTLRQQRFEVRFDTAFADVIAACAEPREPGGGTWISPEIRQAYLRLHELGYAHSVESWVDGTLVGGLYGIALGRAFFGESMFSRRSDASKVALVHLAAHLQRLGFAAIDCQMTTAHLLSLGAEEMPRARFCAGLANWTNEGPGPGRWSCEKAAEISRNFS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.925 kDa

MAIYLPELDPENTLFPKPETALDEPNGLLAFGGDLQPARLLAAYRQGIFPWYSNGEPILWWSPAPRAIFLPNEFKPSKSLRKFYRKSGYQITLNNACHDVIRQCANCRSPEETWITEDMIQAYQTMHNLGHCHSVEVWHQDKLVGGFYGLQIGSVFCGESMFSLADNASKIALWFFCRHFSNQGGTLIDCQVMNNHLESLGALEIPRAPFMQQLHQQRAAIIKPNSFVPQTLKIPIE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.326 kDa

MIPWLAGRPDFPPVEQALEDPDGLLAAGGELSPAWLLAAYRRGIFPWYTEDQPILWWSPDPRLVLIPAHLRISRSLRRTLRQQRFEVRFDTAFADVIAACAEPREPGGGTWISPEIRQAYLRLHELGYAHSVESWVDGTLVGGLYGIALGRAFFGESMFSRRSDASKVALVHLAAHLQRLGFAAIDCQMTTAHLLSLGAEEMPRARFCAGLANWTNEGPGPGRWSCEKAAEISRNFS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.925 kDa

MAIYLPELDPENTLFPKPETALDEPNGLLAFGGDLQPARLLAAYRQGIFPWYSNGEPILWWSPAPRAIFLPNEFKPSKSLRKFYRKSGYQITLNNACHDVIRQCANCRSPEETWITEDMIQAYQTMHNLGHCHSVEVWHQDKLVGGFYGLQIGSVFCGESMFSLADNASKIALWFFCRHFSNQGGTLIDCQVMNNHLESLGALEIPRAPFMQQLHQQRAAIIKPNSFVPQTLKIPIE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.776 kDa

MAIYLTELDSKSLDFPPAENALADPNGLLAFGGDLTPERLIAAYHHGIFPWYGPGEPILWWSPSTRAVFDPNTFLPAKSLKKFQRKAQYQVSINHATPEVIKLCGNTRPAEETWLNEEMQAAYISLALQGVCHSVEVWQDQRLIGGFYGLSIGELFCGESMFSLETNASKIALWYFCRHFSEHGGKLIDCQVMNSHLHSLGAFTLPREEFLQRLLCLKQQRVTSGCFSPQWLKRHNA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.816 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLSAYYNGIFPWFNSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQSGTWITQEIQMAYRELHYTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKAAVAALQQHLLKMGFKLIDAQVMNSHLESLGAKAIKRIDFITLLSELRNNPVDPATWTTKEVILELE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.83 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLSAYYNGIFPWFNSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQSGTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKAAVAALQQHLLKMGFKLIDAQVMNPHLESLGAKAIKRIDFITLLSELRNNPVDPTTWTTKEVILELE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.854 kDa

MKSLSFLNHEFEAFPSPELALNDPNGLLAIGGDLRPERLLSAYYNGIFPWFNSDDPILWWSPDPRAVFIPGEVHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQSGTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKAAVAALQQHLLKMGFKLIDAQVMNPHLESLGAKGIKRIDFITLLRELRNNPVDPATWTTKEVILELE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

237 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.814 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLSAYYNGIFPWFNSDDPILWWSPDPRAVFIPGEIHISTSLRKYLKKQPWRITINHAFTDVMAGCAQPREKQSGTWITQEIQMAYRELHHTGHAHSIEVWEGERLIGGLYGLAIGQVFCGESMFHRKTNASKAAVAALQQHLLKMGFKLIDAQVMNPHLESLGAKAIKRIDFITLLSELRNNPLDPATWTTKEVILELE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.66 kDa

MIVQLDPASISFPPAATALHEPNGLLAVGGDLSPGRLIHAYQQGIFPWFSESDPILWWSPNPRAVFFPDQIHTSRSLAKTNRKPNWQMSINCNFAEVVRACADERADKEGTWITEEMIEAYCKLHQLGYAHSVEIWFDNELAGGLYGISVGRAFCGESMFHYKTDASKIALLRFAQYFKKHGGQLIDCQVGNPHLFSLGAVNLHRERFLMKLNIAQQKKMPDTFWQARELPLPGEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.549 kDa

MRITQLSSQSFAFPSPELALREPNGLLALGGDLSPPRLLAAYERGIFPWFSPGEMILWWSPDPRAVLYPEDLHISRSMRRFLRNCPYRFTLNHAFKDVIRACATLRDEGTWIGDDVQQAYCHLHTLGHAHSVEVWLENELVGGLYGISVGSLFCGESMFSRANNASKSALMVFCHHFTRHGGELIDCQVLNAHTASLGAIEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRVTQLSSQSFIFPSPELALREPNGLLALGGDLTAPRLLAAYQRGIFPWFNPGEMILWWSPDPRAVLFPEDLHISRSMRRFIRHCPYRFTLNHAFADVISACATERDEGTWIGRDVQQAYCQLHALGHAHSLEVWLENELVGGLYGVAVGAVFCGESMFSRADNASKSALMVFCHHFTQHGGELIDCQVLNAHTASLGAVEIPRNFFLQQLSQLQFSPLPAECWLPQSLNFSSAMQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.589 kDa

MTIYLPELEQEHDASFPDIESALHDPDGLLAMGGDLTPKRLLLAYSHGIFPWYSNDDPILWWSPSIRGVFIPENYTPSKSLKKFFKKSGYSITINHATSDVISLCASTRPAEETWIMPEMIEAYQNLAKLGHCHSVEVWFNNELVGGLYGLQIGQVFCGESMFSIKTNASKIALWKFCEHFVAFGGKLIDCQMMNPHLESLGAIPMERPIFNERLQVFSAISVFENCYQPQSLSNG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.891 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLTAYYNGIFPWFNADDPILWWSPDPRAIFMLGKIRISTSLCKYLKKQPWHFTINHAFTSVMAGCAEPRPKQNGTWITDEIQMAYRELHQNGHAHSIEVWEGEQLIGGLYGLAIGQVFCGESMFHRQTNASKAAIVVLQQHLIKRGFKLIDAQVMNPHLESLGAKAIKRTHFIELLTQFRDKKVHPDAWIPSEVFLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.644 kDa

MNSLSYLNHELEQFPSPEFALTDPNGLLAVGGDLQPKRLLNAYYEGIFPWFNIDDPILWWSPDPRAVFVPGNMKTSRSLLKHLKKQPWRYSINHAFSQVIEGCAAPRSSQDGTWITPEIQDAYLKLHELGKAHSIEVWHQDELIGGLYGLATGQVFCGESMFHTQTNASKAAMLLLHQHLLKQGFKLIDAQVMNPHLASLGATALRRKDFINLLKRFRDLPVAADAWARSEVSLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.621 kDa

MAIYLTELGDSHSFPSPYDALNDPNGLLAFGGDLNPDRILNGYHQGIFPWYGPGEPILWWSPSPRAVFDPLAFKPSKSLKKFQRKQQYKVTLNNATERVIQLCSSTRSAEETWLNEEMQTSYIELARRGHCHSVEVWHDEKLIGGLYGISVGQLFCGESMFSLKDNASKIALWYLCEHLASNQGQLIDCQVMNPHLASLGAFELERDDFVQKLLSLRDRNINLGTFEPQVLQGAVS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.631 kDa

MAIYLTELDSTFNFPSPYEALSDPNGLLAFGGDLDPHRILSGYYQGIFPWYGPGEPILWWSPSPRAVFDPLTFKPSKSLKKFQRKHQYKVTINQATEHVIQLCSSTRPADETWLNEEMQAAYIQLSNLGHCHSVEVWHDNTLVGGLYGISVGQLFCGESMFSLKDNASKIALWYLCTHLASKHGQLIDCQVMNPHLASLGAFELDRDEFIQKLLSLREKQTASDTFTPQVLQDSES

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.821 kDa

MTIYLTELDTTSIEFPSPFDALDEPNGLLAFGGDLSPIRILNAYSQGIFPWYGPGEPILWWSPAPRAVFNPKTFEPSKSLKKFQRKHNYRVSINQATDRVIGYCSSLRPEEETWLNNDMQAAYRELASLGFCHSVEVWQGDELIGGLYGLQRGQVFCGESMFSLKTNASKIALWYFCEHFTQFGGQLIDCQVMNPHLESLGAIEVDRDEFLSSLRLLKETSVNDACSKKQWLKEMP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.753 kDa

MIRTLYSDTPFPPLEQALIEPNGLLAAGGDLSPERLISAYRQGIFPWFNPGEIILWWSPDPRMVLFPRELKISRSLHKTLKKNDYQIRTDSAFTEVMQACAAPREDQAGTWIHEEMIAAYTALHQMGVAHSVETWIEGELAGGLYGVAIGRAFFGESMFSRATDASKIALVHLARQLENWGYGLIDCQMKTAHLMSMGAREIPRSQFSKRLNQLNALPGQNRKWYFDFTYPGRSEQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.907 kDa

MNGLSFIDDEQIRFPSPELALSEPNGLLAIGGSLHPKRLLAAYYDGIFPWFNAEDPILWWSPDPRAVFLPGELKISRSLKKSLKKHPWRVTINHAFADVMAGCAQPRKKQRDTWITQEIQLAYLEMHSQGHAHSVEVWMKDRLVGGLYGLAIGKVFCGESMFHRETDASKLAMMALHQHLLQHDFKLLDAQIMNPHLESLGAREVSRTAFLSLLKRYRDEPVAKSCWLPREMPIGK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.524 kDa

MNSLSYLNHDQQGFPPPEQALSDPNGLLAVGGDLRPERLLNAYYNGIFPWFNLDDPILWWSPDPRAVFVPGNMKISRSLVKYLKKQDWTYTINHNFEAVTAGCAEPRAGQDGTWISSEIQQAYLSLHQQGYAHSLEVWQDKQLIGGLYGLAIGQVFCGESMFHRATNASKAAMIVLQQHLQRCGFKLIDAQVVNPHLDSLGAKSIKRDDFLRLLTHLRDGEVSIDSWSKAEVSIEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.972 kDa

MNSLSYLNHELAKFPSPEFALTDPNGLLAIGGDLHPKRLLNAYYEGIFPWFNENDPILWWSPDPRAVFVPGSLKVSRSLKRDIKRRQWRFSVNRAFNSVIEHCALTRQGKEGTWITLEIQQAYKALHKYNKAHSIEVWDGDKLIGGLYGVAIGQVFCGESMFHLQSNASKAAMAMLHQHLLSHRYRLIDAQVMNPHLASLGAKALKRADFINLLKRFRDIEVASDAWHPQEVQIEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.83 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPDRLLTAYYHGIFPWFNAEDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQAGTWITHEIQMAYRELHHNGHAHSIEVWQGERLIGGLYGLAIGQVFCGESMFHRETNASKAAMAVLQQHLIKMNFKLIDAQVMNPHLESLGAKALKRADFIQLLTQFRDDAVNPAAWIPSEVFLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.511 kDa

MNSLSYLNHAQQAFPPPEQALIEPNGLLAVGGDLHPERLLNAYYNGIFPWFNLDDPILWWSPDPRAVFVPGNMKISRSLVKYLKKQNWTYTINHAFEAVTAGCAEPRAGQDGTWISSEIQQAYLSLHHQGHAHSLEVWQNNELIGGLYGLAIGQVFCGESMFHRTTNASKAAMIVLQQHLQRCGFKLIDAQVVNPHLDSLGAKSIKRDDFLRLLAHLRDGTVSLDSWRKSEVTIEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.891 kDa

MKSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLTAYYNGIFPWFNADDPILWWSPDPRAIFMLGKIRISTSLCKYLKKQPWHFTINHAFTSVMAGCAEPRPKQNGTWITDEIQMAYRELHQNGHAHSIEVWEGEQLIGGLYGLAIGQVFCGESMFHRQTNASKAAIVVLQQHLIKRGFKLIDAQVMNPHLESLGAKAIKRTHFIELLTQFRDKKVHPDAWIPSEVFLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.664 kDa

MNSLSYLNQDQQSFPPPEQALSDPNGLLAVGGDLQPERLLNAYYNGIFPWFNQDDPILWWSPDPRAVFAPGNLRVSRSLIKYLKKQSWTFSINKQFPAVIRGCAAPRAKQEETWISDDIQQAYLSLHQQGHAHSIEVWEDDILIGGLYGLAIGQVFCGESMFHLRTNASKAAMIVLQQHLLRCGFKLIDAQVENPHLDSLGAKSIKRKDFLTLLKHLRDGDVNPDSWLTTEVPIEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.816 kDa

MNSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLTAYYHGIFPWFNADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQAGTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGIAIGQVFCGESMFHRETNASKAAMAVLQQHLIKMNFKLIDAQVMNPHLESLGAKPVKRADFIQLLTQFRDKPVNPAAWIPSEVTLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.617 kDa

MNSLSYLNHELERFPSPEYALTDPNGLLAIGGDLHPTRLLNAYYEGIFPWFNADDPILWWSPDPRAVFVPGTMKASRSLIKSLKKQTWTFTINRAFKEVMIGCAAPRAAQDGTWITQDIQHAYLELHKQGLAHSVEVWDEETLIGGLYGLAIGQVFCGESMFHTQTNASKAAMLVLHQYLLKQGFKLIDAQVVNPHLESLGATALKRKDFINLLKRFRDGKVASNSWVVKEVFLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.82 kDa

MNSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLTAYYHGIFPWFNADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWRFTINHAFTDVMAGCAQPRRKQAGTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGLAIGQVFCGESMFHRETNASKAAMLLLQQHLINMDFKLIDAQVMNPHLESLGAKPVKRANFIQLLTQFRDNTANPAAWIPSEVTLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

236 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.801 kDa

MNSLSFLNHEFEAFPSPELALTDPNGLLAIGGDLRPERLLTAYYHGIFPWFNADDPILWWSPDPRAIFIPGQVNISTSLRKYLKKQPWHFTINHAFTDVMAGCAQPRRKQAGTWITHEIQMAYRELHHNGHAHSVEVWHGERLIGGLYGLAIGQVFCGESMFHRETNASKAAMLLLQQHLINMDFKLIDAQVMNPHLESLGAKPVKRANFIQLLTQFRDNTANPAAWIPSEVTLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

27.28 kDa

MIPWLSPYSLEFPDVRLALDEPNGLLALGGDLSPERLVSAYQRGIFPWFNPGDPILWWSPHPRTVVFPHQHHVSRSLRKTLRKGIYRVTFDHCFAQVMRACAAPRAYANGTWISEQMISSYTRLHEQGYAHSVEVWQDENLVGGLYGLSLGKIFFGESMFSRADNASKTGFAYLVRQLQQWDFRLIDCQVASDHLFTLGAVEISRDEFQKMLVHFTEQPRDYPLHWHEIDPETRW

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.359 kDa

MAIYRLPREVSFPDPDLAEPDGLLAVGGDLSPERLLTAYAAGIFPWYGEDTPILWWSPDPRLVLEPERLHVSASLARTIRRGRYRVTADRAFEDVVRRCAGRARPGQDGTWIVPEMIDAYVRLHRLGFAHSFEAWEGEALAGGLYGVSLGGAFFGESMFADRPDASKVAFVRSVEWLARWDVRLIDCQVRTEHLARFGAREIPRAEFLARLGRALDRPTLRGRWDLDAGDRPAGA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.537 kDa

MIPWLTDRPAFPPVERALTEPNGLLAAGGRLTPEWLLAAYRRGIFPWYSDGEPILWWSPDPRLVLQPAQIRITRSLRKVLRGRRFEVRFDTAFARVIEECAAPREPGGGTWITPEIRAAYLRMHELGYAHSVESWLDGRLVGGLYGMALGRAFFGESMFSRVSDASKVALAHLARFLEQRDFGVIDCQMTTPHLLSMGAHEIARREFCAGLERWTVEGPPPAKWSGTTAAEFDWN

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.359 kDa

MAIYRLPREVSFPDPDLAEPDGLLAVGGDLSPERLLTAYAAGIFPWYGEDTPILWWSPDPRLVLEPERLHVSASLARTIRRGRYRVTADRAFEDVVRRCAGRARPGQDGTWIVPEMIDAYVRLHRLGFAHSFEAWEGEALAGGLYGVSLGGAFFGESMFADRPDASKVAFVRSVEWLARWDVRLIDCQVRTEHLARFGAREIPRAEFLARLGRALDRPTLRGRWDLDAGDRPAGA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.537 kDa

MIPWLTDRPAFPPVERALTEPNGLLAAGGRLTPEWLLAAYRRGIFPWYSDGEPILWWSPDPRLVLQPAQIRITRSLRKVLRGRRFEVRFDTAFARVIEECAAPREPGGGTWITPEIRAAYLRMHELGYAHSVESWLDGRLVGGLYGMALGRAFFGESMFSRVSDASKVALAHLARFLEQRDFGVIDCQMTTPHLLSMGAHEIARREFCAGLERWTVEGPPPAKWSGTTAAEFDWN

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.498 kDa

MSRYLTQLDDELCWFPDPEHALEEPNGLLAIGGDLSPARLLAAYHKGIFPWNEPHQPLLWWSPDPRGVIRPEQLHIGRTLRKFIRGTSFDISIDRAFNEVIAACAAPRRSASGTWISTPMIDAYRQLHRLGHAHSIEIWQEGQLQAGLYGLSLGRVFCGESMFSRIDNGAKLAMVALCQHFARHDGALIDCQMQNDFLATLGIEEWPRRQFLTTLAQLSRQPLAANCWQTGSILL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.148 kDa

MPVYRLAAEHNAFPPAEGANEDGLVAVGGDLSPQRLLAAYRSGIFPWYSAGEPLLWWSLDPRLVLRPPALHVPRSLKKAIRQGAFRITFDHVFEQVMHQCGAVRAAEGTWITPEMEQAYLRLHQMGFAHSCESWLMDENHRYQLAGGIYGVAIGGAFFGESMFYRQPNASKVALVALVGHLAQQGYSLMDCQMTTQHMLRFGAVEMPRSVFLEDLQQAIAQPIPAGLWQTVSPLI

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.436 kDa

MLTLIDPNDERQAFPPPDAALKEPNGLLAVGGSLSVARLERAYRRGIFPWYGEGDPILWWSPDPRLVLFPEKLRISRSLRKTLRRRLFRFSFDRAFRAVITACAERREKSEGTWLTADMQSAYLAFHHAGFAHSFEAWQDGALVGGLYGVAMGRIFYGESMFHRVTDASKAALAFAVGCLSHWGYRMIDCQVYSSHLVSLGASTIPRSEFQALVSEYSETSVDPEAWKHAPGDFL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

235 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.345 kDa

MNSLSYLNQSIGFPPPEQALTDPNGLLAIGGDLRPDRLAQAYYQGIFPWFNANDPILWWSPDPRAVFTPSHPFGSKSLIKFLKKSAWRFTINQAFLDVVAGCAGPRNTQDGTWISAEIQMAYYELHLQGHAHSIEVWDGEQLVGGLYGIPVGGIFCGESMFHRQTNASKAAFAILNQHLVKHDFQLIDAQVMNPHLVSLGAKALPRSEFLTILHQYRDRATSASMWNKQEVFIEF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.631 kDa

MIELFQLDKSLHFPPPAHALTDPPGLLAFGGDLSVNRLLHAYQQGIFPWFSANEPILWWSPDPRGILPLDNFSVSKSLRKFIRKTPLRVTVNRRFDEVIYACAKVKRQSSGTWITDDMINAYIELHRCGGAHSIEVWDDEELVGGLYGVTPGNVFCGESMFHYATNASKLAMFYLVELLRLNGCEFIDCQLQNDHLASLGCIEMPRAEFLNRLKEAVKHPMDQSLWLPRELTQP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.481 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAILQPETLHISRSMKRFHKRSPYRVTLNYAFGQVIEGCANDRDEGTWITRDVVEAYHRLHELGHAHSIEVWRHNALVGGMYGVSQGTLFCGESMFSRQENASKTALLVFCAEFIRQGGKLIDCQVLNSHTASLGAVEIPRRQYLEHLGSLRQQRLPGHFWVPRTLFSPQA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.249 kDa

MIPYLGPLDLFPPVEMAREDMGGLLAVGGDLQPDRLLDAYRRGIFPWGTVEGQPLWYSPNPRMVLFPEEFRLTRSLKKTLRSGKFEVRFDSNFRGVMANCASTPRPGQDGTWISPEMKHAYTRLHELGWAHSVETYEEGVMVGGLYGLAIGHMFYGESMFSHRTDASKVAFAHLVDYLVNNQFGMIDCQMYTDHLASLGGREIPRDAFQARLSALTASGSPRTVWSTDPLDPAR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRLYQLSPQSLQFPDPNHALDNPNGLLAVGGDLSVARLKVAYRQGIFPWFSPGEPILWWSPNPRAVLLPGELHLSRSMKKFLKRHTFHATLNQAFDDVIHACAQEHHDGTWITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRMDNASKYALLAFQQHFIRHGGHLIDCQVLNSHTASLGVSEIPRVRFLQQLSQWQDIAVEEGCWLPQQLAEPAF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.426 kDa

MRLYQLSSQSLQFPDPNHALDDPNGLLAVGGDLSVARLKAAYRQGIFPWFSPGEPILWWSPNPRAVLFPDELHVSRSMKKFLKRHTFHATLNQAFDDVIHACAHEHHDGTWITSEIISAYRQLHLAGKAHSVEVWQDDKLVGGLYGVEQGRLFCGESMFSRTDNASKYALLAFQQHFIHHGGHLIDCQVLNAHTASLGVSEIPRDRFLQQLSQWQDLAVDDGCWLPQQLAEPTL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.403 kDa

MRLYQLSPQSLQFPDPNHALDNPNGLLAVGGDLSVARLKVAYRQGIFPWFSPGEPILWWSPNPRAVLLPGELHLSRSMKKFLKRHTFHATLNQAFDDVIHACAQEHHDGTWITPDIISAYRQLHQVGKAHSVEVWHNGALVGGLYGIEQGRLFCGESMFSRMDNASKYALLAFQQHFIRHGGHLIDCQVLNSHTASLGVSEIPRVRFLQQLSQWQDIAVEEGCWLPQQLAEPAF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.426 kDa

MRLYQLSSQSLQFPDPNHALDDPNGLLAVGGDLSVARLKAAYRQGIFPWFSPGEPILWWSPNPRAVLFPDELHVSRSMKKFLKRHTFHATLNQAFDDVIHACAHEHHDGTWITSEIISAYRQLHLAGKAHSVEVWQDDKLVGGLYGVEQGRLFCGESMFSRTDNASKYALLAFQQHFIHHGGHLIDCQVLNAHTASLGVSEIPRDRFLQQLSQWQDLAVDDGCWLPQQLAEPTL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.293 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPEQFHLSRSMKRFHQRSPYRVTLNHAFGEVIEGCASDRDEGTWITSSIVRAYHQLHELGHAHSIEVWQENTLVGGMYGVAQGALFCGESMFSRAENASKTALLVFCQAFTQSGGKLIDCQVLNNHTASLGAVDIPRRDYLDYLSVLRGYRLPELFWVPRVLFPGAQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.584 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVLCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.647 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVAGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHAGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.585 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGAPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWHEDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFISHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.567 kDa

MPVFRLTEELIFPPSYLAERDGLLAVGGDLSAERLLLAYRQGIFPWYTEKTPILWWSPDPRLVLFPAELKISISLRRVLRKNVFSVTFDRAFADVIRRCAEVRRARDDSTWIVPGMVTAYSRLHRLGYAHSVESWHEGELVGGLYGVALGRVFYGESMFTRKTDASKVALVHLVDLLTRGGFQLIDCQVTTAHLQSMGAREISRRRFLTLLAENIPEVVHGESWEGESCCGKRP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.704 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.704 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.565 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWCEDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.704 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.446 kDa

MRLVQLSRHNIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAILEPSQFHLSRSMKRFHAKSPYRVTLNYAFGQVIEGCAADRDEGTWITHDIINAYLRLHELGYAHSIEVWDNDTLVGGMYGVAQGTLFCGESMFSRAVNASKTALLVFCQEFSLRGGQLMDCQVLNEHTASLGAVEITRRHYLDELGNLRQQKLPQNFWVPRTLFMPQV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.733 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPTRLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWRKDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.888 kDa

MPALPWLDENLWFPHPDSALKDPNGLLCVGGDLHPARLRLAYENGIFPWFSEDQPILWWSPDPRCIIRHEDLHISRSMRRFLRNSGLTYSFDQHFTLVVQACAAPRSYSNETWITRDMLQAYSDLHQIGVAHSIEVWRESELVGGLYGLAIGRCFFGESMFSKETNASKAAFITLVRQLHAWGYRLIDCQVPNPHLLSLGACQISRKEFLSILEIEVRADFSHPWKMTIDPTGY

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.654 kDa

MTIYLTELDSTLYFPSPEEALTEPNGLLAIGGDLSPARLLTAYYNGIFPWFSPYQPILWWSPDPRGVLPVAQLHISRSLRKTLNKTSLRFTVNHAFMDVVTACAAPRRYSEDTWITSEFMQSYAVLHEMGQAHSVEVWDNDQLVGGLYGLSVGKLFCGESMFHRQTDASKLALVALCRHLSRYDAPLIDCQMQNSYLETMGVQEWPRAEFLRQLAQLREQSFPAECWQPQVLTL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.26 kDa

MRLYLLPDDACIFPDVGEAGPDGLLAIGGDLTPERLLRAYEEGIFPWYGPGDPILWWSPDPRCVLPLDALHVPRRLMRTVRAKTFEVRLDTAFADVLEQCAATPRPGQGGTWLVPEMRAAYTRLHHLGHAHSVEAWYGGRLVGGLYGVALGGGFFGESMFHAMPDASKVAFVWLARLLVSWGFRFVDCQQTTSHMLRFGAVEMPRTDFLACLHDATRQPSRIGRWRLPQDFVPW

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.26 kDa

MRLYLLPDDACIFPDVGEAGPDGLLAIGGDLTPERLLRAYEEGIFPWYGPGDPILWWSPDPRCVLPLDALHVPRRLMRTVRAKTFEVRLDTAFADVLEQCAATPRPGQGGTWLVPEMRAAYTRLHHLGHAHSVEAWYGGRLVGGLYGVALGGGFFGESMFHAMPDASKVAFVWLARLLVSWGFRFVDCQQTTSHMLRFGAVEMPRTDFLACLHDATRQPSRIGRWRLPQDFVPW

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.732 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIRHGGKLIDCQILNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.704 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.618 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRNYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.618 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRNYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.565 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWCEDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.703 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVKAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCDEFIRHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.619 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEGCASDREEGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSPQE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.789 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEEFHLSRSMKRFHNTSPYRVTLNYAFDRVIDGCTNHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRKENASKTALLVFCAEFIHHGGKLIDCQVLNSHTASLGAIEIPRCDYLEHLSRLRQQPLVSRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.71 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGIYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNNHTASLGAIEILRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.685 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.685 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.685 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.643 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAGLRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.685 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.643 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFIRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAGLRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.645 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDQELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVINSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.158 kDa

MPIYLLSDEHPELFPPPERADKSGVVAVGGDLRPERLLAAYARGIFPWYSEGDPILWHSPDPRFVLSPDKLHVGRSLRKTMARGIYEVRYDTAFRRVITECSQVPRPGQTGTWITEEMMEAYVTLHEAGFAHSVEAWAEGELKGGLYGVSLGAAFFGESMFALAPDASKVAFVTAAERFQGWGFQLIDCQVETEHLARFGAENWPRRRFLSALARAMKEPTRRGKWTEGAAADP

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.658 kDa

MIRTLFSDTPFPPLEQALIEPNGLLAAGGDLSPERLISAYQQGIFPWFNQGEVILWWSPNPRMVLFPQELKISRSLHKTLKKNHYQIRTDSAFTQVMQACAAPREKQTGTWIHPEMVAAYTTLHQRGIAHSVETWVDGELVGGLYGVAIGKAFFGESMFSRVPDASKIALVYLARQLERQGYGLIDCQMKTAHLMSMGAREIPRLQFSKLLGKLTDQPEQNRKWHFDFTWPKQQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

234 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.673 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQHGIFPWFSPGDPILWWSPDPRAVLWPEKFHLSRSMKRFHNASPYRVTLNYAFDRVIDGCANHRDEGTWITRGIEEAYRRLHELGHAHSIEVWRDRELVGGMYGVSQGALFCGESMFSRQENASKTALLVFCAEFTRHGGKLIDCQVLNSHTASLGAIEIPRRDYLDHLAALRQQPLASRFWVPRTLFLPRK

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.447 kDa

MIPWLGPEPVFPPVSQALSHPNGLLAAGGDLSSRRILTAYSEGIFPWFSDGEPILWWSPAPRMVMFPDELKVSRSLAKTLRNLDYEIRVDSAFPEVMRACAEPRAGQDGTWIVPEMVAAYCRLHQIGYAHSFETWIDGELAGGLYGVSIGRMFYGESMFSRRRDASKLAFVHMVRHLQAQGVTMIDCQMHTEHLASLGARLISRDVFLATLKENVRHPQPDRMWDYHYRHESS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.818 kDa

MPVFRLTDKLVFPHPSLADEDGILAVGGDLSCERLLLAYKNGIFPWFSEDEPILWWSPNPRCVLFPKDIKISRSMRKFLKKQLYEVTFDTCFRHVIAMCAKLREGNTWITPEIIESYSKLHDLGFAHSVETWYEGRLVGGLYGVSLGKCFFGESMFSTMDNASKTALITLCQKLEEKGFLLIDCQVYSKHLESLGAVNIDRDLFLKYLEAGLSHETLRGNWKFFNEQKQVRNN

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.814 kDa

MPIFRLPREPAFPDPALAEPDGLLAVGGDLEPERLLTAYAEGIFPWFDAESPILWWSPDPRLVLDPAALHVPRSLQRTLRRGAYRVSADEAFERVIRRCAERDRPGQQGTWITGEMVDAYVRLHRLGVAHSFEAWEGDALAGGLYGVSLGAAFFGESMFADAPDASKVAFVRSVEWLRSAGVELVDCQVRTEHLVRFGAREIPRAEFLARLARALEQPTLRGRWQLGGAGPPS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.814 kDa

MPIFRLPREPAFPDPALAEPDGLLAVGGDLEPERLLTAYAEGIFPWFDAESPILWWSPDPRLVLDPAALHVPRSLQRTLRRGAYRVSADEAFERVIRRCAERDRPGQQGTWITGEMVDAYVRLHRLGVAHSFEAWEGDALAGGLYGVSLGAAFFGESMFADAPDASKVAFVRSVEWLRSAGVELVDCQVRTEHLVRFGAREIPRAEFLARLARALEQPTLRGRWQLGGAGPPS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.217 kDa

MRLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPEQFHLSRSMKRFHQRSPYRVTLNHAFGEVIEGCASDRDEGTWITSSIVRAYHQLHELGHAHSIEVWQENTLVGGMYGVAQGALFCGESMFSRAENASKTALLVFCQDFAHSGGKLIDCQVLNNHTASLGAVDIPRRDYLDYLSVLRGYRLPERFWVPRVLFPGG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.115 kDa

MIAWLDEDEPFPPVEQALTEPSGLLAASADLPVSRLVTAYRRGIFPWFNPGEPVLWWSPDPRMVLYPAELHVPRSLEKVLRHRRYTVTVDRAFGSVIRACAAPTPARPASWITPEIISTYSQLYRLGLAHSVETWIDGQLAGGFYGVMIGRMFYGESMFAQAPDASKIAFAHLMRRFAGHGIDMIDCQMHTAHLARFGGREIPRSDFVATVNTLTAQPAPPDLWRWSHCNEPA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.814 kDa

MPIFRLPREPAFPDPALAEPDGLLAVGGDLEPERLLTAYAEGIFPWFDAESPILWWSPDPRLVLDPAALHVPRSLQRTLRRGAYRVSADEAFERVIRRCAERDRPGQQGTWITGEMVDAYVRLHRLGVAHSFEAWEGDALAGGLYGVSLGAAFFGESMFADAPDASKVAFVRSVEWLRSAGVELVDCQVRTEHLVRFGAREIPRAEFLARLARALEQPTLRGRWQLGGAGPPS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.958 kDa

MPIFRLPREPAFPDPALAEPDGLLAVGGDLEPERLLTAYAEGIFPWFDAESPILWWSPDPRLLLDPAALHVPRSLQRTLRRGTYRVSADQAFERVIRRCAERDRPGQQGTWITAEMVEAYVRLHRLGLAHSFEAWDGDALAGGLYGVSLGAAFFGESMFADAPDASKVAFVRSVEWLRSAGVELVDCQVRTEHLVRFGAREVPRAEFLARLARALEQPTLRGRWQLEAAGPPS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.122 kDa

MPVYALSEAICFPDPSLARADGLLAVGGDLSPERLLNAYCMGIFPWYSEGEPILWWSPNPRLILIPSRFHMSSSLKKTLRQKRFAVTLDTAFKDVMAACAAVRQDHGEGTWIVPEMEKAYRRLHQAGFAHSVEAWQDGELAGGLYGVSLGRGFFGESMFFKRSNASKAAFAVLVEFLTAHEFEFIDCQMKTPHLMSLGAEERPRSVFLDMLHQTLEFPTLRGRWSLESENGLA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

233 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.288 kDa

MKSLCYLNQEDCFPAAHKALTDPNGLIAIGGDLQPERLLSAYQQGIFPWFNQGEPILWWTPDPRAVFQLSDYRPSRSLMKTLKRQTWRFTINKAFDAVIHQCAALRQEGTWITPAIKAAYGQLHAQGDAHSIEVWQGEQLVGGLYGIAVGKIFCGESMFHLETDASKAAFHLLVTHLRRFEFTLIDAQVMNPHLARLGAKPLPREAFLTQLAQLKHQHSPATAWQPQEVKLGY

aat

Leucyl/phenylalanyl-tRNA--protein transferase

232 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.703 kDa

MIPWLSSDSLFPPLHTALIQPNGLLAVGGDLSPRRLIEAYSQGIFPWFNDGDPILWWSPDPRMVLFPRELKVSRSLQKSLRKGNYEIRTDRNFTPVMRACAAPRRDSCGTWIQNKMIFAYSALHEMGFAHSVETWMDGELVGGLYGVALGRVFFGESMFSRVSNASKIAFVHLVRQLERWGFEMIDCQMKTAHLASLGAREIPREEFSQRLKELVNYMERGEKWCFDHEQVE

aat

Leucyl/phenylalanyl-tRNA--protein transferase

231 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.505 kDa

MMPIIQLNADSYDFPHPKEALTEPNGLLAVGGDLSAKRLNAAYHQGIFPWFLPSEMPLWWSPDPRAVIIPGELHIGRTLRRFLRNTPYHITVNHAFEQVVHFCAQRQEGTWIGKDIQQGYKKLYQTGQAHSVEVWHNERIVGGLYGVSVGTLFCGESMFSRMENASKCAFIAFYHHFLRHGGELLDCQVLNHHTASLGAKEIPREEFIQYLYQFRNRSLKAGCWLQQVLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

231 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.505 kDa

MMPIIQLNADSYDFPHPKEALTEPNGLLAVGGDLSAKRLNAAYHQGIFPWFLPSEMPLWWSPDPRAVIIPGELHIGRTLRRFLRNTPYHITVNHAFEQVVHFCAQRQEGTWIGKDIQQGYKKLYQTGQAHSVEVWHNERIVGGLYGVSVGTLFCGESMFSRMENASKCAFIAFYHHFLRHGGELLDCQVLNHHTASLGAKEIPREEFIQYLYQFRNRSLKAGCWLQQVLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.529 kDa

MPIYQLIDELVFPPLDHAEPGGLLAVGGDLSPRRLLLAYSMGIFPWFNADDPILWWSPDPRCVLALSAFYLNRSLSKELRRGRYEVTFDKAFSEVIRACARTPRKEGPGTWITGDMLKAYELLHGLGYAHSVEAWYEGCLVGGLYGVALGGCFFGESMFHCMPNASKVAFATLVRHLAMLGYHLIDCQQSSRHLLSMGATEVPRAEFLQLLQNAGVHPSTLPPKGKFPSR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.881 kDa

MPLFQLDEHDVTFPAPHLALKEPSGLLAIGGDISPARLKEAYQTGIFPWYTPHETPLWWSPDPRAVLPAGTLHIGRTLRKFLRQAPYTITLNQAFSDVIEACSVRDEGTWIGPDIKTGYRALHQQGEAHSVEVWEGDELIGGLYGVNVGAVFCGESMFSRRNNASKCAFVAFYNHFLRYGGQLFDCQVLNSHTAALGAIEIARDRYLEALSRWKKVIIDKKCWYQQSLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.529 kDa

MPIYQLIDELVFPPLDHAEPGGLLAVGGDLSPRRLLLAYSMGIFPWFNADDPILWWSPDPRCVLALSAFYLNRSLSKELRRGRYEVTFDKAFSEVIRACARTPRKEGPGTWITGDMLKAYELLHGLGYAHSVEAWYEGCLVGGLYGVALGGCFFGESMFHCMPNASKVAFATLVRHLAMLGYHLIDCQQSSRHLLSMGATEVPRAEFLQLLQNAGVHPSTLPPKGKFPSR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.881 kDa

MPLFQLDEHDVTFPAPHLALKEPSGLLAIGGDISPARLKEAYQTGIFPWYTPHETPLWWSPDPRAVLPAGTLHIGRTLRKFLRQAPYTITLNQAFSDVIEACSVRDEGTWIGPDIKTGYRALHQQGEAHSVEVWEGDELIGGLYGVNVGAVFCGESMFSRRNNASKCAFVAFYNHFLRYGGQLFDCQVLNSHTAALGAIEIARDRYLEALSRWKKVIIDKKCWYQQSLEL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.636 kDa

MFIKNLSKNIIDFPKPEKALKDPNGLLASGGDLSPERLLVAYQNGIFPWFNEGEPILWWSPDPRAVLLKCHVSRSMKRFIRPGRCPYHFSLNCAFSDVITTCATKRSGCTWISSDIVKAYCQLHRLGRAHSVEVWLKDKLVGGLYGISVGAMFCGESMFSIADNASKSALIIFEHYFTQKGGKWIDCQVLNAHTACLGAEQIPRNDFLSLLDQAQRVSLPKGVWSPQSLG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

230 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.344 kDa

MRLAQLSHESLNFPPPDRALREPNGLLAMGGDLSPQRLLNAYHRGIFPWFAAGDPILWWSPDPRAILLPQHFHLSRSMKRFHQKSPYRVTLNQRFRQVIEGCASDRQEGTWITYEVKLAWQRLHELGHAHSIEVWQDEELVGGMYGLALGQIFCGESMFSQGENASKTALLVFSRYFLQQGGKLIDCQVLNPHTQSLGAQEIPRASYLSYLHSLAFRPLSSECWSPQRLF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.172 kDa

MLTWLNRNNLDFPPLEKALREPDGLLAAGGDLSADRLIKAYRHGCFPWFQEGQPILWWSPDPRTVLLPEELHISRSLGKVLRQSRYRVTFDTDFARVIKACAAPRSYANETWITGSMQDAYLELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVGFATLVEHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLARHLDQPTDADWLSRRV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.966 kDa

MLTWLNRNSLDFPPLEKALREPNGLLAAGGDLSADRLISAYRHGCFPWFQDGQPILWWSPDPRTVLFPEELHISRSLAKVLRQSRYRVTFDQDFASVIKACAAPRSYANETWITGSMQAAYVELHRRGHAHSVEVWDQDELVGGLYGLAMGQLFFGESMFSRADNASKVGFATLVEHLTAWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQPTDADWSARRV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.521 kDa

MTARDSASSDITPEMLLRAYACGIFPMAESVDDPTLFWVEPEQRGLIPLDGFKVSSRLARTVRSDAFTVTVDRAFKAVIDGCAAPQQGREDTWINRRIRELYIGLFEIGHCHSVEVWQDDELVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLLEGGYALLDTQFVTDHLRSFGAVEVPRRRYRTLLDAALKDDARFDRLPIDAPVSGAQALEIIAARPTPKR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.127 kDa

MLTWLNRNSLDFPPLEKALREPNGLLAAGGDLSADRLLNAYRHGCFPWFQDGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANETWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGQLFFGESMFSRADNASKVGFATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQPSGADWSYRRV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.127 kDa

MLTWLNRNSLDFPPLEKALREPNGLLAAGGDLSADRLLNAYRHGCFPWFQDGQPILWWSPDPRTVLFPEELHVSRSLGKMLRQSRYHVTFDRDFASVIKACAAPRSYANETWITGSMQDAYLELHRRGHAHSVEVWDQNELVGGLYGLAMGQLFFGESMFSRADNASKVGFATLVQHLTDWGFVLIDCQMPTQHLHSFGARSIPRQTFADYLSRHLDQPSGADWSYRRV

aat

Leucyl/phenylalanyl-tRNA--protein transferase

229 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.602 kDa

MPVFRLSDRLVFPSPHLARHDGLLCLGGDLTPERILLAYQNGIFPWFSPGDPLLWWSPDPRLVILPGQLRVSRSLQKRINRNVYTITMDQAFGRVINACADLRNRSGQGTWLVQEMIEAYIGLHERGYAHSVEAWNAGTLAGGLYGISLGGCFFGESMFSTMADSSKTALAALDRHLVKQKFDLIDCQVKTDHLVSMGGVEIPRKDFLTRIHGSLEKKTIKGPWIFTGF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

228 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.748 kDa

MLSALSNDPMYFPPLETAFDNGLLAYGGDLSPQRLLSAYTKGIFPWYDNNSPILWWSPDPRCILLPENFRIPKTIQRELKKCTFSVTINNAFTEVITACATLPRTKQKGTWITQDMKMAYIQLHKLGFSHSIEVWDNSTLVGGLYGVALGKAFFGESMFHIAPHASKLALVWLAQYLWSYNFDFIDCQMPTTHIMRYGATLISRNEFLTRLTIAVTTGTSQASTKEAL

aat

Leucyl/phenylalanyl-tRNA--protein transferase

228 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

26.283 kDa

MIPKLLKHELTFPHPNDATEDGIVAWGGDLNPSRLIRAYQNGIFPWYGKNDPIIWWSPNPRLIMELDDFKLSRSLRKSMKKFEYRFDTNFINVMKNCQNIKRVKQDGTWIQDEIIEAYSVLHDMGIAHSVESYLDGELVGGLYGVAVGGLFCGESMFTLVNDASKSAYAVLINHLKIWGYDFIDAQVPTEHLKNLGAKEVSRDYFLDRLHKVNMNIINHKWELLHVNT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

228 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.573 kDa

MKEPFTNASYFPPVETALVDPNGLLAIGGDLSQERLLDAYRHGIFPWFNPREPIQWWSPDPRMVLPPAEIRVTRSLAKRLRNAGFELRVDSAFIEVMRACGAPREGAWGTWISAPMIAAYGRLFDAGYAHSIETWRDGRLVGGLYGVAIGRMFYGESMFSREPDASKVALVRLARQLERWGFGLIDCQMETPHLASMGARPIPRADFTARLAELVNLPHLPGPWTFDS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

227 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.911 kDa

MSSRDSAASEITPEVLLRAYACGIFPMAESADDPGLFWVEPEQRGIFPLEALRISSRLARTVRSDRYRITIDTAFERVLGECAAPAPGREDTWINNRIRKLYSGLFEIGHCHSIEAWDGDDLAGGLYGVSLGGAFFGESMFHRSRDTSKVALVHLAARLIIGGFTLLDTQFVTDHLRSLGATEVPRRKYRALLDRALQLPGDFFALPADRPVSGADVLAIVRGTTAT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

227 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.911 kDa

MSSRDSAASEITPEVLLRAYACGIFPMAESADDPGLFWVEPEQRGIFPLEALRISSRLARTVRSDRYRITIDTAFERVLGECAAPAPGREDTWINNRIRKLYSGLFEIGHCHSIEAWDGDDLAGGLYGVSLGGAFFGESMFHRSRDTSKVALVHLAARLIIGGFTLLDTQFVTDHLRSLGATEVPRRKYRALLDRALQLPGDFFALPADRPVSGADVLAIVRGTTAT

aat

Leucyl/phenylalanyl-tRNA--protein transferase

227 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.99 kDa

NMTVFRLNRDCTFPHPKHAESDGLLAVGGDLSAKRLINGYRDGIFPWYSEGDPILWWYTHPRFVIYPDRFTAGKRLMRYWKKTSYTFTIDQAFSQVIGLCGSSRTGRGEETWILPEMREAYGQLHELGYAHSVECWDVDRLVGGLYGVELGGVFFGESMFSTVSNSSKFCLIYLVEQARKRGVQLIDCQMTTRHLLQFGAVEISGEKFYQHLQLLIADIGPQPAWKI

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.671 kDa

MLTWLSRTNYDFPPLDKALQEPNGLLAAGGDLDPRRLIAAYRHGCFPWYQDGQPILWWSPDPRTVLLPEELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRDYADGTWITTPMQLAYQELHLRGVAHSVEVWQAGQLVGGLYGLAMGRLFFGESMFSRADNASKVGFVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISREAFADYLQRYRDESPSGTLDF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.827 kDa

MLTWLSRTDFDFPPLDKALQEPNGLLAAGGDLNPQRLVAAYRHGCFPWYQDGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRDYADGTWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVGFVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDLDF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.808 kDa

MLTWLSRTDFDFPPLDKALQEPNGLLAAGGDLNPQRLVAAYRHGCFPWYQDGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNHDFRAVIQACAAPRDYADGTWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVGFVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDLDF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.826 kDa

MLTWLSRTDFDFPPLDKALQEPNGLLAAGGDLNPQRLVAAYRHGCFPWYQDGQPILWWSPDPRTVLFPDELHVSRSLAKCLRQQRFEVTFNRDFRAVIQACAAPRNYADGTWITTPMQLAYQELHLRGIAHSVEVWQERQLVGGLYGLAMGRLFFGESMFSRADNASKVGFVTLVRHLRDAGFVLIDCQMPTRHLHSLGARAISRGEFADYLQRYRDQPPTGDLDF

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.321 kDa

MLTWLTRDSLTFPPLEKALHDPNGLLAAGGDLTPERLVAAYRHGCFPWYQDGQPILWWSPDPRTVLFPEELHISRSLAKFIRQGHYQVSFDSDFPAVIEACAAPRDYADGTWITDSMRAAYCELHRRGFAHSVEVRREGELVGGLYGLAMGRLFFGESMFSRADNASKVGFVALVEHLKQAGFVLIDCQMPTNHLHSLGARAISRAEFADHLARHLDQPSGASWVR

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.622 kDa

MLTWLQRNTLDFPPLEKAMREPNGLLAAGGDLSADRLIQAYRHGCFPWFSEGQPILWWSPDPRTVLFPDELHVSRSLGKLLRKQHYQVTFDRDFAAVISACAAPRAYADGTWISEAMQRAYLQLHQRGYAHSVEVWDQGVLVGGLYGLAMGQLFFGESMFSRADNASKFGFATLVERLKAWGFVLIDCQMPTEHLHSLGARSISRPEFANYLKHHLDLPSRAIWVS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.347 kDa

MLTWLQRDSLTFPPLAKAMREPNGLLAAGGDLSAERLIQAYRHGCFPWFSQGQPILWWSPDPRTVIFPDELHISRSLGKLLRQQRYTVTFDQDFAAVIQACAAPRAYADGTWITQSIQNAYLALHQRGYAHSVEVWDNGELVGGLYGLAMGQLFFGESMFSRADNASKFGFATLTRQLQAWGFVLIDCQMPNDHLHSLGARAISRSDFAGFLRDHLDQPNTGPWVS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.562 kDa

MLTWLQRDSFQFPPLAKAMREPNGLLAAGGDLSAERLISAYRHGCFPWFQDGQPILWWSPDPRTVLFPQELHISRSLAKLLRQQRYRVTFDQDFAAVIAACAAPRAYADGTWITRGMQEAYRQLHQRGIAHSVEVWQGEQLVGGLYGLAIGQLFFGESMFSRADNASKVGFATLVGKLQEWGFVLIDCQMPTQHLHSFGARAIPRATFADYLQRHLNLPSRADWLA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.194 kDa

MLTWLTRDSLTFPPLEKALHDPNGLLAAGGDLSPERLVQAYRHGCFPWYQDGQPILWWSPDPRTVLLPDQLHVSRSLAKLMRQGRYQVSFDTDFPAVIAACAAPRDYADGTWITDTMRNAYCELHRRGIAHSVEVRQDGELVGGLYGLAMGQLFFGESMFSRADNASKVGFVTLVNHLRDAGFVLIDCQMPTNHLHSLGAHAISRAEFASYLARHLDQPNSASWVA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.735 kDa

MLTWLQRNSLTFPPLEKAMRDPNGLLAAGGDLSADRLIQAYRHGCFPWFSEGQPILWWSPDPRTVLFPDELHVSRSLGKLMRKQRYRVTFDQDFDAVIRACAAPREYADGTWITEAMQDAYIELHRRGFAHSVEVWDEGELVGGLYGLAMGQLFFGESMFSRADNASKYGFATLVQHLREAGFVLIDCQMPTDHLHSLGARAISRQTFADYLARHLDQPNHATWVC

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.188 kDa

MLTWLTRDSLTFPPLEKALHDPNGLLAAGGDLSPERLVQAYRHGCFPWYQDGQPILWWSPDPRTVLLPDQLHVSRSLAKLMRQGRYQVSFDTDFPAVIAACAAPRDYADGTWITDTMRNAYCELHRRGIAHSVEVRQDGKLVGGLYGLAMGQLFFGESMFSRADNASKVGFVTLVNHLRDAGFALIDCQMPTNHLHSLGAHAISRAEFADYLAHHLDQPNSATWVA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.194 kDa

MLTWLTRDSLTFPPLEKALHDPNGLLAAGGDLSPERLVQAYRHGCFPWYQDGQPILWWSPDPRTVLLPDQLHVSRSLAKLMRQGRYQVSFDTDFPAVIAACAAPRDYADGTWITDTMRNAYCELHRRGIAHSVEVRQDGELVGGLYGLAMGQLFFGESMFSRADNASKVGFVTLVNHLRDAGFVLIDCQMPTNHLHSLGAHAISRAEFASYLARHLDQPNSASWVA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.341 kDa

MLTWLTRDSLTFPPLEKALQDPNGLLAAGGDLSPERLVQAYRHGCFPWYQDGQPILWWSPDPRTVLFPNELHVSRSLAKLLRQGRYQVSFDTDFPAVIDACAAPRDYADGTWITDTMRNAYCELHRRGIAHSVEVRHNGELVGGLYGLAMGRLFFGESMFSRADNASKVGFVTLVKHLQEAGFVLIDCQMPTDHLHSLGARAISRASFADYLAHHLDQPNSASWRS

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.597 kDa

MLTWLKRDDLSFPPLETALREPNGLLAAGGDLRPERLLAAYRHGCFPWYQEGQPLLWWSPDPRTVLFPDELHVSRSLRKRMRHGDYRVTFDKAFAEVIQGCAGPRSYADGTWITTPMQDAYVRLHEMGVAHSVEVWQQGQLVGGLYGLAMGELFFGESMFSRATDASKVGFVTLVERLREWGFALIDCQMPTRHLESFGARSIPRAAFAEALAMHLDRPSAADWRA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.7 kDa

MLTCLQRDSLSFPPLERALHQPNGLLAVGGDLSAERLIQAYRHGCFPWYQAGQPILWWSPDPRTVLFPRELHVSRSLRKVLRQERFQVSFDRDFAAVIQACAGPRDYADGTWITPEMRKAYQELHHRGIAHSVEVWQNGVLVGGLYGLAIGQLFFGESMFSHADNASKVGFATLVERLERWGFVLIDCQMPTQHLQSLGARSIPRTEFSDYLMHHLDLPSTADWIA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.561 kDa

MTSRDSASSEITPAVLLRAYACGIFPMAESADDPTLFWVEPELRGVIPLGGFRVASRLARTVRSDGFRVTVNTAFKATIAGCAAPQAGREDTWINKRIRDLYSGLFELGHCHSVEAWQGDDLVGGLYGVSLGRAFFGESMFHTARDASKVALVHLVARLIHGGFELLDTQYVTEHLKNFGAVEIPRRRYTALLDKALAGEPGDFLKLSPGEAIPGARALEIIASRQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.859 kDa

MNSRDSAASEITPEVLLRAYACGIFPMAESADDPSLFWVEPELRGVIPLTGFRVSSRLARTVRSDAFTVTVNQAFTAVMDGCAEPQPGREDTWINRRIRELYSGLYALGHCHSVECWQDGDLVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTGLLEKALTGPAANFTRLSIDQPISGTEALAIIAERH

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.728 kDa

MNSRDSAASEITPEVLLRAYACGIFPMAESADDPSLFWVEPELRGVIPLDGFRVASRLARTVRSDAFTLTVNQAFKAVMDGCAAPQPGREDTWINRRIRELYGGLHAMGHCHSVECWQDGELVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTVLLEKALTGPAANFARLPTDRPLAGAEALAIIAERG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

25.7 kDa

MLTCLQRDSLSFPPLERALHQPNGLLAVGGDLSAERLIQAYRHGCFPWYQAGQPILWWSPDPRTVLFPRELHVSRSLRKVLRQERFQVSFDRDFAAVIQACAGPRDYADGTWITPEMRKAYQELHHRGIAHSVEVWQNGVLVGGLYGLAIGQLFFGESMFSHADNASKVGFATLVERLERWGFVLIDCQMPTQHLQSLGARSIPRTEFSDYLMHHLDLPSTADWIA

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.561 kDa

MTSRDSASSEITPAVLLRAYACGIFPMAESADDPTLFWVEPELRGVIPLGGFRVASRLARTVRSDGFRVTVNTAFKATIAGCAAPQAGREDTWINKRIRDLYSGLFELGHCHSVEAWQGDDLVGGLYGVSLGRAFFGESMFHTARDASKVALVHLVARLIHGGFELLDTQYVTEHLKNFGAVEIPRRRYTALLDKALAGEPGDFLKLSPGEAIPGARALEIIASRQ

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.859 kDa

MNSRDSAASEITPEVLLRAYACGIFPMAESADDPSLFWVEPELRGVIPLTGFRVSSRLARTVRSDAFTVTVNQAFTAVMDGCAEPQPGREDTWINRRIRELYSGLYALGHCHSVECWQDGDLVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTGLLEKALTGPAANFTRLSIDQPISGTEALAIIAERH

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

24.728 kDa

MNSRDSAASEITPEVLLRAYACGIFPMAESADDPSLFWVEPELRGVIPLDGFRVASRLARTVRSDAFTLTVNQAFKAVMDGCAAPQPGREDTWINRRIRELYGGLHAMGHCHSVECWQDGELVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLIAGGFELLDTQYVTEHLKTFGAVEIPRRRYTVLLEKALTGPAANFARLPTDRPLAGAEALAIIAERG

aat

Leucyl/phenylalanyl-tRNA--protein transferase

226 amino acids

Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.