Functions in the N-end rule pathway of protein degradation where it conjugates Leu, Phe and, less efficiently, Met from aminoacyl-tRNAs to the N-termini of proteins containing an N-terminal arginine or lysine.

Belongs to the L/F-transferase family.

263 amino acids

MSRIEPHAIPPELLLKAYRAGIFPMADSRDDPEVFWVEPKMRAILPLEGFHLSRSLARTLRRGKFTVTCNAAFEAVIDACAAPRPGAEESWISARIRESYIGLHEHGHAHSIECWHNGRLVGGLYGVGFARVFCGESMFSREPDASKVALAWLVASLRKVGAELLDCQFTTPHLASLGAVEIPQSQYLQLLSKAQRPYSSGELAAARALADAVGDGLGIGGAGVVKGDAAALGLPAGFAALRAEGAGSSSPGNVIAQSLTHTS

27.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aat using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here