wdr4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4

467 amino acids

Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit.

Belongs to the WD repeat TRM82 family.

52.703 kDa

MSTTAVFIPPQIMVTSNVEKVPISIITHSSDSNFIAYRLNNKLNIFDNKLNKLGELESGSQHTGIIRSIEFTKNNQSLITSSSDKFLKIWDTTNNFKNIKSINTNKKIICSILNKDDSEILVSDKCGDVFKYSLIDDSKNKIEVSGDKSAKHDEKESDKNLVFGHYSSIVDIKFSPCFNYLLSADRDEKIRVSHYPNCFDIESFCLGHTKYVTEILLVPGRDDLLISGSGDGTIKLWNWKQGKCLQTVDFNSKHENAITIPQVVFKVDATTTTNQLIFSIENSNNIYILPMNVEKGEFNQSELKTIPLTQSSPISIDLIDNGKTILASLLPTTKEVDVAIAFDSTTLSQQSDNKVVIAINSVDASTTLKPAELKSVLESIEKKQYRKHVSYSKQMMNSTDNKNKEDDDLSLDEQDIDDTTDINNNNKNKNQETIQDSRPLKLRKMTIEGDKEIQKELEEKESKKQEE

WDR4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

414 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs, such as let-7. Acts as a regulator of embryonic stem cell self-renewal and differentiation. Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1.

Belongs to the WD repeat TRM82 family.

45.858 kDa

MASSAGLALCGHALVVRGGSRLLATSTSSSDGDSLFIYDCSAAEKKSQENKGEDGQPVDQGSDTVLASTFSKSGSYFVLTDDSKRLILFRTNPWQCLSVRTVVRRCTALTFTASEEKILVADKSGDVYSFSVLEPHGGGRLELGHLSMLLDVAVSPDDRFVLTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRIFVVPNHPELLLSSSGDCTLRLWEYRSGRELHCCPLTSLQEPTEPWSDKRFAVSRITYWSQEDCVALSCDGLPVVYIFQLDAAQRQLVPRQLLTFQHRVWDAAFEEGHGLWVLQDCREDPLVLYRPVGGQWQSAPESAELRRVCAHVRVNWAMLEGCAGVDSGFSSLYKATCDNMTTYLKKKEERLQQQLEKKRRQAPPPGPNGPTKKMRAGELAQGCSS

wdr4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4

413 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs.

Belongs to the WD repeat TRM82 family.

46.24 kDa

MAVVCSKADWFVTSCSTTLVAVNLKQSREPFVFDCSKAEKKPKEADVDNKSAGEGSEEKDSDSILAFAISASGKHVALTDDHKRLVLFCTEPSWKCISTRWVVRRCTSLAFTQAEDELYVADKSGDVYSFSILEPHKAGELKLGHLSMLLDVALSPDDKYIITADRDEKIRVSFRRSPYNIQAFCLGHTEFVSSLLVPAGHPDWLLSGSGDGTVNVWHYETGRRLHSVDMRKFGLDSENTEKRFAVSRIISSPDGQHVAVQCEGFPSVQLFTVDCGTEGLLKPADTLTLPLSPWDVTFDSENQLWVLLESEDMKVLLYRHSEQHWRLCDSESPELKKVTNALQTQWHLFKGSVGLESQFKHLYKVNFDNMASYLQKKQERLDLEHKKRAAAANGSKPNKKSKTESGAVPQSTS

Wdr4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

413 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:29983320). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit (By similarity). Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (PubMed:29983320). Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs (By similarity). Also required for methylation of a specific subset of miRNAs, such as let-7 (By similarity). Acts as a regulator of embryonic stem cell self-renewal and differentiation (PubMed:29983320). Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1 (PubMed:29574139).

Belongs to the WD repeat TRM82 family.

45.756 kDa

MASSAGLALCAQTLVVRGGSRFLAFSTTGSDDDCVFTYDCSTAEKKATPEDKGEDGQPADTGSDSILASTFSKSGRYFALTDDSKRLILFRTKPWQCLSVRMVVRRCTALTFTASEDRVLVADKSGDVYSFSVLEPDGCGRLELGHLSMLLDVAVSPDDQFVLTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRILVVPSHPELLLSSSGDGTLRLWEYRSGRQLQCCDLAGLQEPGEQPGHKGLAASRIAFWGQESYVVLLCECVPVVFVFQLDASRQQLVFRQRLTFPHRVWDVVFEEARGLWVLQDCRDAPLVLWRPVGGEWQAAPDGAVSPRLCSHLRESWAMLEGSVGTDDSFRSLYKATFDNMTSYLKKKEERLQQQLKKKRQRSPFPGSPEQTKKACPGQSALSC

WDR4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4

412 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:12403464, PubMed:31031084, PubMed:31031083). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit (PubMed:12403464). Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (PubMed:12403464, PubMed:31031084). Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs (PubMed:31031084). Also required for methylation of a specific subset of miRNAs, such as let-7 (PubMed:31031083). Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1 (PubMed:26751069).

Belongs to the WD repeat TRM82 family.

45.49 kDa

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

wdr4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4

396 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs.

Belongs to the WD repeat TRM82 family.

43.646 kDa

MLRVGPGSLAITGGSRLLGHRVGSECCPFHLDCSLLEKQSAAPGQEGSADSHGSDKILAAAFSPSGEYFALTDDNKRLVLFRTKPAWEKISVRWVSRRCTALTFSPCGNHILVADKSGDVFSFSVPRALEQGRLELGHLSMLLDVTVSLDGKHIITCDRDEKIRVSCWGAPHVIMSFCLGHTEFVSQLLPLPGQEKLLLSGSGDGTLRLWEYESGKEVHSVTLRSLAHELEDQENKRFAVSRISCCSCNGIQLAVLCEGVPGIFLFSVSPEPRLTFTQYIALTHTPIDLDFDGSAFLWVLSGVREEPLLKYKELDDQWQSVSNDEELTRLTGIIQENWGDLEGAGAPESRFVGLYKAVFDNMATYLQKKELRLESEKRKAADGQVVLASKVQKTES

wdr4

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4

396 amino acids

Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs.

Belongs to the WD repeat TRM82 family.

43.559 kDa

MLRLGSSGLALTGSSRVLGHRAGSECPPFHLDCSSLEKQSAAPGQEGSVDPQGSDKILAAAFSPSGEYFALTDDNKRLILFQTKPAWETISVRWVSRRCTALTFSPCGAHILVADKSGDVFSFSVRRSREAGRLELGHLSMLLDVAVSPDGNHIITCDRDEKIRVSRWDSPHVIMSFCLGHTEFVSQLLPLPGADKLLLSGSGDGTLRLWDYESGREVQSVTLSGLDLGMERQENKRFTVSRISCCACNGIQLAMLCEGVPGIFLFSVAPGPRLTLTQYVALTHTPLDLDFDGSAYLWVLSGDWEEPLLKYKELNGQWQSVVNDEEVTRLSGFIRENWADLEGAGAPENRFAVLYKAVVDNMATYLQKKELRLENEKRKTTEGQVAPASKVQKTEC