Description
Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs.
Family
Belongs to the WD repeat TRM82 family.
Species
Xenopus tropicalis
Sequence
MLRLGSSGLALTGSSRVLGHRAGSECPPFHLDCSSLEKQSAAPGQEGSVDPQGSDKILAAAFSPSGEYFALTDDNKRLILFQTKPAWETISVRWVSRRCTALTFSPCGAHILVADKSGDVFSFSVRRSREAGRLELGHLSMLLDVAVSPDGNHIITCDRDEKIRVSRWDSPHVIMSFCLGHTEFVSQLLPLPGADKLLLSGSGDGTLRLWDYESGREVQSVTLSGLDLGMERQENKRFTVSRISCCACNGIQLAMLCEGVPGIFLFSVAPGPRLTLTQYVALTHTPLDLDFDGSAYLWVLSGDWEEPLLKYKELNGQWQSVVNDEEVTRLSGFIRENWADLEGAGAPENRFAVLYKAVVDNMATYLQKKELRLENEKRKTTEGQVAPASKVQKTEC
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service