Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs, such as let-7. Acts as a regulator of embryonic stem cell self-renewal and differentiation. Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1.

Belongs to the WD repeat TRM82 family.

414 amino acids

MASSAGLALCGHALVVRGGSRLLATSTSSSDGDSLFIYDCSAAEKKSQENKGEDGQPVDQGSDTVLASTFSKSGSYFVLTDDSKRLILFRTNPWQCLSVRTVVRRCTALTFTASEEKILVADKSGDVYSFSVLEPHGGGRLELGHLSMLLDVAVSPDDRFVLTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRIFVVPNHPELLLSSSGDCTLRLWEYRSGRELHCCPLTSLQEPTEPWSDKRFAVSRITYWSQEDCVALSCDGLPVVYIFQLDAAQRQLVPRQLLTFQHRVWDAAFEEGHGLWVLQDCREDPLVLYRPVGGQWQSAPESAELRRVCAHVRVNWAMLEGCAGVDSGFSSLYKATCDNMTTYLKKKEERLQQQLEKKRRQAPPPGPNGPTKKMRAGELAQGCSS

45.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make WDR4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here