tmub1

Transmembrane and ubiquitin-like domain-containing protein 1

312 amino acids

May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly.

34.295 kDa

MIEGLGDEVTVAVGLFILLLAITLAWLSTYVAEGSDPLLGSLIPTGRRDPLLVLSNPVPASPEPQRPAEAQAEKPEEGEQDPGGEQEAGSENANLDQMLDIQGVSKRSHAVPPLREEDGTEQDVTQEDDKEAESPLIVGRKIEQEEEKPLAKEGMTREKPEEALMTVRLKFLNETEEVAMVRPNDTIGMLKSKYFPGQEQQMKLIFQGQLLHDSSQTLCSLHITDNCVIHCHRSQATTPTSSSSPESGGSSQEHTGLTPPIGNLMIPVFVVMLALIWYFRINYRQFFTAPATVSLVGVTVFFSFLVFGMYGR

tmub1

Transmembrane and ubiquitin-like domain-containing protein 1

308 amino acids

May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly.

33.155 kDa

MALIEGVGDEVTVLFALVLFFMVLMLAWVSTHTTERAPTHWIRPEPAQGGASSNSQRDFHPGPSQTLTNADPNSETVDSSDSTQSSREFQNAGATPHSEVAFSSSGSTVSTGGSVEYTGAAADSPPDGESHPNFTVSSRDPQAGASSSLRYRGLGDGTTAQSAEEAGTIHLRLKFLNDTERLVTVRLSDTIMYIKRTYFPGQELRVRLIFQGQLLRDDSQTVSSLQLRDGSVLHCHISQHASVPGVGADQANVPLNVGNLLVPLLFLIVMLLWYCQFQYPSLFTGTATACLGGFTLLISAIAFSSYHR

tmub1

Transmembrane and ubiquitin-like domain-containing protein 1

292 amino acids

May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly.

31.079 kDa

MALIEGVGDEVTLLFGVVFLVLVLVLAWASTHTVEPPEHLLSPSPGASPSTETDSQEPLPPGNTDSSPGGVRDEDDKSEPGTEAGAAGQSADGSRAGGGDGGLLDDAGLGSDGLRHRESAGPSTHPPESTPSATQPSAEDAASDTHRNMVLRLKFLNDTERTAQVNPQDTIGYIKRTYFAGQEHQVRLIYQGQLLQDDSQTLASLNLADNSVLHCHISQHATRAMPAGARAADQVHVALNVGSLMVPLFVLMLSVLWYFQIQYRQFFTAPATASLVGITIFFSFVAFGVYRR

TMUB1

Transmembrane and ubiquitin-like domain-containing protein 1

246 amino acids

iHOPS: May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation. May be involved in centrosome assembly. Modulates stabilization and nucleolar localization of tumor suppressor CDKN2A and enhances association between CDKN2A and NPM1 (By similarity).

26.206 kDa

MALIEGVGDEVTILFSALACLLVLALAWVSTHTAEGADPLPQPSGTPTPTQPSEAMAVTDSIRGEAPGAETPGLRHRGQAAPPEPSVGLAATPPPPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQHVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPLPPCPPGSEPGPSGLEVGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

TMUB1

Transmembrane and ubiquitin-like domain-containing protein 1

246 amino acids

iHOPS: May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). May be involved in centrosome assembly. Modulates stabilization and nucleolar localization of tumor suppressor CDKN2A and enhances association between CDKN2A and NPM1 (By similarity).

26.261 kDa

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Tmub1

Transmembrane and ubiquitin-like domain-containing protein 1

245 amino acids

iHOPS: May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (PubMed:16014383). May be involved in centrosome assembly (PubMed:18418082). Modulates stabilization and nucleolar localization of tumor suppressor CDKN2A and enhances association between CDKN2A and NPM1 (PubMed:22890319).

26.316 kDa

MALIEGVGDEVTVLFAVLACLLVLALAWVSTHTTESTDPQPQPPGTTTPAQPSEAMSASDSIREEAPGAESPSLRHRGPSAQPEPDTGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGQEQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Tmub1

Transmembrane and ubiquitin-like domain-containing protein 1

245 amino acids

iHOPS: May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). May be involved in centrosome assembly. Modulates stabilization and nucleolar localization of tumor suppressor CDKN2A and enhances association between CDKN2A and NPM1 (By similarity).

26.349 kDa

MALIEGVGDEVTVLFSVLACLLVLALAWVSTHTTESTDPLPQSSGTTTPAQPSEAMTAIDSIREEAPGAESPSLRHRGPSAQPEPEAGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP