May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly.

308 amino acids

MALIEGVGDEVTVLFALVLFFMVLMLAWVSTHTTERAPTHWIRPEPAQGGASSNSQRDFHPGPSQTLTNADPNSETVDSSDSTQSSREFQNAGATPHSEVAFSSSGSTVSTGGSVEYTGAAADSPPDGESHPNFTVSSRDPQAGASSSLRYRGLGDGTTAQSAEEAGTIHLRLKFLNDTERLVTVRLSDTIMYIKRTYFPGQELRVRLIFQGQLLRDDSQTVSSLQLRDGSVLHCHISQHASVPGVGADQANVPLNVGNLLVPLLFLIVMLLWYCQFQYPSLFTGTATACLGGFTLLISAIAFSSYHR

33.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tmub1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here