About Products Protein Database Contact

Protein expression services for tmub1 | Transmembrane and ubiquitin-like domain-containing protein 1

Description
May contribute to the regulation of translation during cell-cycle progression. May contribute to the regulation of cell proliferation (By similarity). The membrane form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase HMGCR. May be involved in centrosome assembly.
Species
Xenopus tropicalis
Length
312 amino acids
Sequence
MIEGLGDEVTVAVGLFILLLAITLAWLSTYVAEGSDPLLGSLIPTGRRDPLLVLSNPVPASPEPQRPAEAQAEKPEEGEQDPGGEQEAGSENANLDQMLDIQGVSKRSHAVPPLREEDGTEQDVTQEDDKEAESPLIVGRKIEQEEEKPLAKEGMTREKPEEALMTVRLKFLNETEEVAMVRPNDTIGMLKSKYFPGQEQQMKLIFQGQLLHDSSQTLCSLHITDNCVIHCHRSQATTPTSSSSPESGGSSQEHTGLTPPIGNLMIPVFVVMLALIWYFRINYRQFFTAPATVSLVGVTVFFSFLVFGMYGR
Mass
34.3 kDa
Simulated SDS-PAGE
Western blot of tmub1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tmub1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here