PIF1

ATP-dependent DNA helicase PIF1

929 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of mitochondrial (kinetoplast) genome stability. Essential for replication of kinetoplast minicircles. Involved in the segregation of minicircle progeny.

Belongs to the helicase family. PIF1 subfamily.

102.508 kDa

MLRRLLQPAYNVALSGTSASTLPRKSASVGLVRTALMPVDYNAGALFCAMRFTSGTEKERKREPKRGSKRRSKATTTLSTPTDAQTSVTGAREGVALPQENMPDAIQPPATLEVRAAEVKEEPLAATPPQIQPQEETMGPIDGEPQLPLHSTLVYNALTGRMTSETSPSFLCLKSIGFGVNNKRQLYVEKPDVLRDLAQRMRKGTATLPSNWPVTIIRALGVILRNRRVEDPAEAIQQMMQVKINNLTHSRYAAVVNAVGDTDLQNILDGGLADEFVAVDLNEEQEKVINLALKGHLMYIGGSAGTGKTVLLRALCRRMQAEGLRVAMTATTGVAGCHIGGSTFHHAMGVSAQGDFVRKNHLLSYDAIIIDEVSMLPKKMFEEFDRVLREEAGAPDVPFGGVQIILCGDFLQLGVINEPPIIHSTTFREKFVKIRLETQVRQAKSSLFADALQQMRVGLVPESLTASVEQLPPGTMVPAAVNLLPTNKEVNTANEEELKRLPGDAVTLTPETGITALRCDTTATLLMRTTKDFKVEEFTKHLRGLLQATVDIPRASMVSAYRIYEDGHAVRVYLPQSESVAWRDAIRERFLEVAGLINDLDIGATVTEIIPSGDGLHTPEHEECLQRLMAKHPIAQPLTLKKGCRVLLRTNLTSRLVNGSIGTVVDFVECSMENIPVALRCERVNRCVDRYRIYCTMECGMPVPLLPVVKFHSGETIVVPPWEFLVGGNPITQYYSLSSVSLPLSLAYAFTVHKVQGLTLVGRVHLELSRMWPCEHLLYVAMSRVRNPEQLSMSSFDPKMVLANEACVKFDRELNTVDNLPSLAEYPVSSWKRCNDMVYHLRRQGTSLDRYLQNGAAKEGGSVPVQQLGLSGPVKGSLEHSMVVSRRLRKLIKQTERTIRMHERRQKKMAVEGAKQTDTTKASSGESLE

PIF1

ATP-dependent DNA helicase PIF1

906 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Involved in the maintenance of ribosomal (rDNA). Required for efficient fork arrest at the replication fork barrier within rDNA. Involved in the maintenance of mitochondrial (mtDNA). Required to maintain mtDNA under conditions that introduce dsDNA breaks in mtDNA, either preventing or repairing dsDNA breaks. May inhibit replication progression to allow time for repair. May have a general role in chromosomal replication by affecting Okazaki fragment maturation. May have a role in conjunction with DNA2 helicase/nuclease in 5'-flap extension during Okazaki fragment processing.

Belongs to the helicase family. PIF1 subfamily.

101.321 kDa

MLNANKSIIRLATYSIRNRIHHLRTLHSLNYINSRINIQDTNHIRPTCPCGSKQFMLESELDSALIEFLDNDDPFSDSEIKESDDLSKGQSHVYNGSPVTKNSILQIEKQQIQKSPRPTETNKRMQIRKDPDQNDNVDDDSLSSTFEFSDMDDDFMEALKAAEEITGNNTNCIKRTASTPLKKPIAKSMKNSSTPSKSAGKKYCKYIKTSSPSPSHYLIRESGSGVDILEGSPNKVQADNASPFRITSSFSSPSQIQNQGVGANPGPKSKAEQNVSSASQSSSPPMTVSQVRNPFKVPTQFRRNYSTRPITNQGSDTKKGNSHHTILLATQKPGVPFSNPSDRSYHKLEKTEGINEAQSEAKNVKPIILSNEQEYVLKQVLSGVSLFYTGSAGTGKSVLLRSIIKSLRDKYPKGVAVTASTGLAACNIGGITLHSFAGFGLGQGKVENLIKKIKRNKKAFTRWRETRVLIIDEISMVDGHLLNKLNEIAKNLRRNNRPFGGIQLVACGDFYQLPPVVKKTAHDGTELDDVEVFFAFESSAWKETIQRTITLKEIFRQKGDQRFINMLNNLRDGNVPDDTARDFCRLSRPLKCPEGIVPSELYATRYEVDMANSRKLNTIQGDVVVYNSVDTGILPEPQKTQVLTNFLAPQVLNLKVGAQVMCIKNFDDQLVNGTLGKVIDFVDRDTYMKSESKENPSTETSDEVSGLNDYIFNDFQKPKKVVKEDAPIAEQVLFTGQLSQKVEEESESSKRKSKLKDDLMKDYKNKKYPLVKFLLPDGITFRTVVVEPEQWTTEDEDGTVLVSRIQFPLILAWSLSIHKSQGQTLSKVVVDMKKIFENGQAYVALSRAVSRAGLQVLNFNRSKVASHRKVIEFYKNLSSHEKESRSGQQRLNFMQTSVKSVARAQI

PIF1

ATP-dependent DNA helicase PIF1

859 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Appears to move along DNA in single nucleotide or base pair steps, powered by hydrolysis of 1 molecule of ATP. Processes at an unwinding rate of about 75 bp/s. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Involved in the maintenance of ribosomal (rDNA). Required for efficient fork arrest at the replication fork barrier within rDNA. Involved in the maintenance of mitochondrial (mtDNA). Required to maintain mtDNA under conditions that introduce dsDNA breaks in mtDNA, either preventing or repairing dsDNA breaks. May inhibit replication progression to allow time for repair. May have a general role in chromosomal replication by affecting Okazaki fragment maturation. May have a role in conjunction with DNA2 helicase/nuclease in 5'-flap extension during Okazaki fragment processing (By similarity).

Belongs to the helicase family. PIF1 subfamily.

97.628 kDa

MPKWIRSTLNHIIPRRPFICSFNSFLLLKNVSHAKLSFSMSSRGFRSNNFIQAQLKHPSILSKEDLDLLSDSDDWEEPDCIQLETEKQEKKIITDIHKEDPVDKKPMRDKNVMNFINKDSPLSWNDMFKPSIIQPPQLISENSFDQSSQKKSRSTGFKNPLRPALKKESSFDELQNSSISQERSLEMINENEKKKMQFGEKIAVLTQRPSFTELQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKSDIGEPVSPLDSSVFDFMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVKKRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNSGIAAMLQRHSRKRFQLKKESNSNQVHSLVSDEPRGQDTEDHILE

PIF1

ATP-dependent DNA helicase PIF1

859 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Appears to move along DNA in single nucleotide or base pair steps, powered by hydrolysis of 1 molecule of ATP. Processes at an unwinding rate of about 75 bp/s. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Involved in the maintenance of ribosomal (rDNA). Required for efficient fork arrest at the replication fork barrier within rDNA. Involved in the maintenance of mitochondrial (mtDNA). Required to maintain mtDNA under conditions that introduce dsDNA breaks in mtDNA, either preventing or repairing dsDNA breaks. May inhibit replication progression to allow time for repair. May have a general role in chromosomal replication by affecting Okazaki fragment maturation. May have a role in conjunction with DNA2 helicase/nuclease in 5'-flap extension during Okazaki fragment processing.

Belongs to the helicase family. PIF1 subfamily.

97.682 kDa

MPKWIRSTLNHIIPRRPFICSFNSFLLLKNVSHAKLSFSMSSRGFRSNNFIQAQLKHPSILSKEDLDLLSDSDDWEEPDCIQLETEKQEKKIITDIHKEDPVDKKPMRDKNVMNFINKDSPLSWNDMFKPSIIQPPQLISENSFDQSSQKKSRSTGFKNPLRPALKKESSFDELQNNSISQERSLEMINENEKKKMQFGEKIAVLTQRPSFTELQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKSDIGEPVSPLDSSVFDFMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVKKRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNSNQVHSLVSDEPRGQDTEDHILE

pif1

ATP-dependent DNA helicase PIF1

745 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability.

Belongs to the helicase family. PIF1 subfamily.

83.072 kDa

MFKKAVKDHSAAAARPLQSTIPNSSGVASTKLPPPQSIGVKRKIELTSTKSTLGSLHSAVYFDENDFDDDDDLDFESPDPYIPPARIEKDSFREESFHAAKSNSTLSHKADSQSAVTVSKTNYESDIKYPDLPPVPPDDNPGPSSSALPWSSSPPSHFQKPAAPRTVPWRKQENNIITIDDEAKPETPARPAATAPWNKTASAIKEEQKELRRQNKKAQAQKTQSSTKHHMPRAQVAPIFLSQKHVLKAVVEKGQSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRIAVTASTGLAACNIEGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLVIDEVSMVDGDLFDKLEEIARLIRNNGRPFGGIQLVVTGDFFQLPPVPEGHNREAKFSFAAASWNTSIQHTILLTHVFRQRDPEFADMLNEMRLGKLSPRTIQAFKELSRPLDFHDALEATELFPTRAEVDNANSARMARLSGETMTFNAVDSGTIQDIQFREKLLSNCMAPQTIHLKKGSQVMLIKNMEDTLVNGSIGRVVAFMDEATFDFYVENENDFASGKFDEGDEDRAARARKKIKGMGHRDGGVTVTRKWPLVCFIQPDGTERHLLCQPESWKIELPNGEVQAQRQQVPLILAWALSIHKAQGQTLQRVKVDLGKVFEKGQAYVALSRATSKAGLQVLRFDPRKVMVHPKVIEFYRNLVHASDLIKSKQPPKPQRTISNGDEDVYIDELIAEAEAY

pif1

ATP-dependent DNA helicase pif1

659 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase that efficiently unwinds G-quadruplex (G4) DNA structures. May be involved in resolving commom issues that arise during DNA replication, recombination, and repair.

Belongs to the helicase family. PIF1 subfamily.

72.807 kDa

MKQATALDILKTGKNVFLTGSAGSGKTYTLNEYIHYLRARRVPVATTASTGIAATHMNGITIHSWSGIGIKDELTERDLVNLSRKKVLKDRLQETAVLIIDEISMLHAKQLNLVNQVLKHMRQNDKPFGGIQVVVAGDFFQLPPVGSRGESNRDKFAFMSQAWLDAGFKICYLSEQHRQQSGEGEDAQITLDNILNQIRGENGVSAAAIAALQNTFYQDVDVNRTRLYTHNVNVNKINEHELALLEGETVTYNAIAHGDNKLVETLKKSVRTSDELTLKTGAKVMFIKNNSELGVSNGTMGELIGFTTIKPLKLSIATIDDGSADEDGSAEALDEALETLEDAEALAQNESDKPLVSTDRYPIVRLNSGRQVIAEGEEWIVEDESGEILASYTQIPLTLAWAITIHKSQGMTLDAAEIDLSKTFELGQGYVALSRLKSLEGLKLLGMNDLSLRLDPLARGADSRFKDLSLEAQQAFEDIEREVLQESHERFVIASGGTLNKANIAAFEKEYKNRKKKQAQKLAQKDKLSNQLSDHSESTLMATRILLEESLSIAEIAQSRGLAQSTIMGHVARLRRQDPSLNCEHLRPDEAILNKVSKAVDAIIAAGDPNDFNAADDSTQSVKGGDDFDKQRIKLRPIYEYLKQQIDYNTIRLALVFID

Pif1

ATP-dependent DNA helicase PIF1

650 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Possesses an intrinsic strand annealing activity.

Belongs to the helicase family. PIF1 subfamily.

70.942 kDa

MRSGLCTPAEALEMPSSTEAATDECDDAELRCRVAVEELSPGGQPRKRQALRAAELSLGRNERRELMLRLQAPGPTGRPRCFPLRAVRLFTRFAATGRSTLRLPTDGVPGAGSVQLLLSDCPPERLRRFLRTLRLKLAVAPGPGPASARAQLLGPRPRDFVTISPVQPEELQRAAATKAPDSALEKRPMESQTSTEAPRWPLPVKKLRMPSTKPKLSEEQAAVLRMVLKGQSIFFTGSAGTGKSYLLKHILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCMALANRPGVRQGWLNCQRLVIDEISMVEADFFDKLEAVARAVRQQKKPFGGIQLIICGDFLQLPPVTKGSQQPQFCFQAKSWRRCVPVILELTEVWRQADQTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQDDVALTNEKWLKALPGDVHSFEAIDSDPELSRTLDAQCPVSRVLQLKLGAQVMLVKNLAVSRGLVNGARGVVVGFESEGRGLPRVRFLCGITEVIRTDRWTVQVTGGQYLSRQQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDSRVLHFYATLRQGRGLSLESQDDEEANSDLENMDPNL

PIF1

ATP-dependent DNA helicase PIF1

641 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Possesses an intrinsic strand annealing activity.

Belongs to the helicase family. PIF1 subfamily.

69.799 kDa

MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAPGPAGRPRCFPLRAARLFTRFAEAGRSTLRLPAHDTPGAGAVQLLLSDCPPDRLRRFLRTLRLKLAAAPGPGPASARAQLLGPRPRDFVTISPVQPEERRLRAATRVPDTTLVKRPVEPQAGAEPSTEAPRWPLPVKRLSLPSTKPQLSEEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCVALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVARAVRQQNKPFGGIQLIICGDFLQLPPVTKGSQPPRFCFQSKSWKRCVPVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQDDVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQVMLVKNLSVSRGLVNGARGVVVGFEAEGRGLPQVRFLCGVTEVIHADRWTVQATGGQLLSRQQLPLQLAWAMSIHKSQGMTLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMAVRCDPRVLHFYATLRRGRSLSLESPDDDEAASDQENMDPIL

pif1

ATP-dependent DNA helicase PIF1

639 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability.

Belongs to the helicase family. PIF1 subfamily.

71.411 kDa

MLGQMEPAELQCTVAVERLNPAGQAIKRQLIRKGTVTLGRNEFQEMILRVHDGKAPQNFMLRDFQLFTRFAKDGKCTVKFVPENTQVLVSDCPPDRLKMFLKTLSIKHQASQSSKPLSDREKLRAGLPRAFETVSPLQLKDVEKANELRSRVNAPMQPRCLAERPVNKVLGDRKQVKRPRPDCDASPVKALHPNKKPVLVLPVAQKLSKEQTAVLNAVLSGKNVFFTGSAGTGKSFLLKRIVGSLPPKSTYATASTGVAACHIGGTTLHSFAGIGSGSAPLEQCIELAQRPGVLRHWTSCKHLIIDEISMVEAEFFDKLEAIARSIRRSTEPFGGIQLIVCGDFLQLPPVTKGKEKANFCFQSRSWRKCIHMNMELMEVRRQTDKTFISLLQAVRVGRVTEEVTAQLLKSANHCIERDGILATRLCTHKDDVELTNENKLKQLPGVVRMYEAVDSDPMLVQTIDAQSPVSRLLQLKVGAQVMLTKNLDVQRGLVNGARGVVVDFQPGNQGLPRVRFLCGAVEVMKRERWMFKAPGGLYLSRQQLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVQANQDVLIFYKRLRKERLLMQSSMNDFVGQSNKENSRW

Pif1

ATP-dependent DNA helicase PIF1

637 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Possesses an intrinsic strand annealing activity.

Belongs to the helicase family. PIF1 subfamily.

69.758 kDa

MPSSTEVATDECDDTELRCRVAVEELSPGGQPRKRQALRAAELSLGRNERRELMLRLQAPGPEGRPRCFPLRAVRLFTRFAAVGRSTLRLPADGVPRAGSVQLLLSDCPPERLRRFLRTLRLKLAVAPGPGPASARAQLLGPRPRDFVTISPVQPEELRRAAATKAPDSALEKRPMESQPSMEAPRWPLPVKKLRMPSSKPKLSEEQAAVLRMVLKGQSIFFTGSAGTGKSYLLKHILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCVALAHRPGVRQGWLNCQRLVIDEISMVEADFFDKLEAVARAVRQQKKPFGGIQLIICGDFLQLPPVTKGSQHPRFCFQAKSWRKCVPVTLELTEVWRQADQTFISLLKAVRLGRCSDEVTRQLRATAAHKVGRDGIIATRLCTHQDDVALTNEKRLKELPGDVHSFEAIDSDPELSRTLDAQCPVGRVLQLKLGAQVMLVKNLAVSRGLVNGARGVVVGFESEGRGLPRVRFLCGITEVIRTDRWTVQVTGGQYLSRQQLPLQLAWAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDSRVLQFYATLRQGRGLSLESQDDEEASSDLENMDPNL

pif1

ATP-dependent DNA helicase PIF1

635 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability.

Belongs to the helicase family. PIF1 subfamily.

70.954 kDa

MMLAEQLSPEIQSSITIEYLNSSGQALKRKVIRNSFISLGRNEFRDLVLKVSDGKLQQNFVIKQIQLFTRFIRDGKASVVLLPENIQLLISNCPADKLKHFMKTLLIKHEAGKKEKPVNERTRLLSGLPRMFETISPVQKKDVEQANEMRAKANSETPVKGKGLSHKGVNGGNRCQQKRTRTESSNSLIADLRPSKKPTLSMPKQIRLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPPKSTYATASTGVAACHIGGTTLHAFAGIGSGKASLEQCIELAKRPGVRQHWTSCKHLIIDEISMVEGEFFDKLEAVARAVRGKDEPFGGIQLIVCGDFLQLPPVTQASSQTKFCFQGKSWRKCIHLTMELTEVRRQTDKNFISLLQAIRLGRCTDDVARQLLQTTNHKVERDGILATRLCTHKDDVEITNERRLQQLPGESHSYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRGLVNGARGVVIKFEEGNKNLPVVRFLCGVTEVIKPDRWVFKGHGGIYLSRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRANPYVLQFYHQMQKERALRQTSLDDFLDKENC

PIF1

Transcription factor PIF1

478 amino acids

Transcription activator. Regulates negatively chlorophyll biosynthesis and seed germination in the dark, and lightinduced degradation of PIF1 relieves this negative regulation to promote photomorphogenesis. Binds to the G-box motif (5'-CACGTG-3') found in many light-regulated promoters. Promotes the expression of SOM, and thus modulates responses to abscisic acid (ABA) and gibberellic acid (GA).

52.864 kDa

MHHFVPDFDTDDDYVNNHNSSLNHLPRKSITTMGEDDDLMELLWQNGQVVVQNQRLHTKKPSSSPPKLLPSMDPQQQPSSDQNLFIQEDEMTSWLHYPLRDDDFCSDLLFSAAPTATATATVSQVTAARPPVSSTNESRPPVRNFMNFSRLRGDFNNGRGGESGPLLSKAVVRESTQVSPSATPSAAASESGLTRRTDGTDSSAVAGGGAYNRKGKAVAMTAPAIEITGTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQMMSMGCGMMPMMYPGMQQYMPHMAMGMGMNQPIPPPSFMPFPNMLAAQRPLPTQTHMAGSGPQYPVHASDPSRVFVPNQQYDPTSGQPQYPAGYTDPYQQFRGLHPTQPPQFQNQATSYPSSSRVSSSKESEDHGNHTTG

pif1

ATP-dependent DNA helicase pif1

447 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase that efficiently unwinds G-quadruplex (G4) DNA structures. May be involved in resolving commom issues that arise during DNA replication, recombination, and repair.

Belongs to the helicase family. PIF1 subfamily.

51.967 kDa

MFDKLEKILAYDNVFLSGGAGVGKSFLTNELIKSYRKQKKLAIALGSSALSAFNIGGVTLHSFFCLGYCDDMMKLSVLDRNQKQKEKLTKLKELLKTIELIIIDEISMVSANVFEMIGFRLKNSQFNGKILVVGDFFQLPPVIKEKKETLFNHSYYAFSSFFWQDLNFKNIKLSQPKRTQNMEFYNHLSLIRQGFLDEKILSFFESLRIDYKELENLEDDYTLLCGINKKVNNINQEKLSKLETPLVCFKAQVKKEDKRIKDEELDSWIRSLNILEELNIKIGARIIFCVNNWDKNYYNGEQGIIEDILYEEEKIYISIIKNNGMKILLEPYTFFMEELEQSGKDFVVNILASVTQFPIKLAYAITIHKSQGMSIEKLVCDIDHIFENGQLYVALSRATNPNTLKIYSTKKINFGFYFANILKIDSNVIEFYKKHNFLDLEIQEQII

pif1

ATP-dependent DNA helicase pif1

439 amino acids

DNA-dependent ATPase and 5'-3' DNA helicase that efficiently unwinds G-quadruplex (G4) DNA structures. May be involved in resolving commom issues that arise during DNA replication, recombination, and repair.

Belongs to the helicase family. PIF1 subfamily.

49.135 kDa

MNSESKCYRFYICFARLGSGMIAGLMPVHEIELSPEQASALDLLRSGENVFLTGGAGSGKSFLIRQFMRELDPKEMPILASTGAAAVLLGGRTFHSFFGLGIMEGGADATYERASKDKRLMSRLRKVEGVIIDEISMIPGQALMIAEALSQRARESKLPWGGMRVIAVGDFAQLPPVTHTGQRDWCFLNGVWEVSGFQTVMLSHNQRVSDNLFLDVLSDVRHGKVTERVREFLNEHVQDHDEDDPGTRLFPRKINAEKFNERKLAEIDETEVVIESIYSGSERHIETLKKASPIAEKLILKIGCQVMFLQNDPQRRWVNGTRGTVVDITADQITVRKDRGREVQVSKSSFAIQDAEGNIMAQVEQFPLTLAYATTIHKSQGATLDDLWCDLSQLWEPGQAYVALSRLRSAKGLHLIGWNPRSIIVDPKVLHFYKQFEGL