Description
DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Possesses an intrinsic strand annealing activity.
Family
Belongs to the helicase family. PIF1 subfamily.
Sequence
MPSSTEVATDECDDTELRCRVAVEELSPGGQPRKRQALRAAELSLGRNERRELMLRLQAPGPEGRPRCFPLRAVRLFTRFAAVGRSTLRLPADGVPRAGSVQLLLSDCPPERLRRFLRTLRLKLAVAPGPGPASARAQLLGPRPRDFVTISPVQPEELRRAAATKAPDSALEKRPMESQPSMEAPRWPLPVKKLRMPSSKPKLSEEQAAVLRMVLKGQSIFFTGSAGTGKSYLLKHILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCVALAHRPGVRQGWLNCQRLVIDEISMVEADFFDKLEAVARAVRQQKKPFGGIQLIICGDFLQLPPVTKGSQHPRFCFQAKSWRKCVPVTLELTEVWRQADQTFISLLKAVRLGRCSDEVTRQLRATAAHKVGRDGIIATRLCTHQDDVALTNEKRLKELPGDVHSFEAIDSDPELSRTLDAQCPVGRVLQLKLGAQVMLVKNLAVSRGLVNGARGVVVGFESEGRGLPRVRFLCGITEVIRTDRWTVQVTGGQYLSRQQLPLQLAWAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDSRVLQFYATLRQGRGLSLESQDDEEASSDLENMDPNL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service