PAM16

Mitochondrial import inner membrane translocase subunit TIM16

149 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.

Belongs to the TIM16/PAM16 family.

16.216 kDa

MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAKAKAGDASTAKPPPNSTNSSGADNSASSNQ

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

147 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

16.5 kDa

MAHRLIYQVVVTGTQVFAKAFTQAYKQAATAQAASKTSKSAASKFGGLQLDEACKILDVDETALDKVVAELNKKHKLEDIAESESVLAQIDKKFTHLYTVNSEHKSGSFYLQSKVYRAMERIRGELELDPLPKPEIEEPKKKEEEKK

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

146 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

15.993 kDa

MAHRALVKIVITGTRVLGHAFAEAYRQAAAQSAAKQGASAMGRNKTGRGNAAAEYGGITLDESCKILNLDAAKDLKLDKVNQRFDYLFNINDKEKGGSFYLQSKIYRASERLKWELAQREKEAAEEKLPKAEDASEDTGEKSPPSS

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

139 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

15.622 kDa

MAHRAFIQVIFTGAQVFGRAFAESYRQAAAQTAKQTANASRGRGASAEYGGITLDESSKILNIENEQDMNLDKINERFKYLFEINDKEKGGSFYLQSKIYRAAERLKYELAEKEKAANPELNQEQAKSSSTTESPELKK

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

138 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

15.147 kDa

MAHKFVVTAFLTGSRILGRSFVAAYKQAQAASAYQRAQVKAGNTTGGASLSSGMTLDEACKILNVKPPAGGQANVEEVLSRYKRLFDANDPQKGGSFYLQSKIVRAKERFEREIGPLREKMEAEAEIKEGFKPKVYKD

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

136 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

15.233 kDa

MAHRVLVQVIFTGARVFGRAFTEAYKQTAAQMAKQGTSSAARSQGGMTNEYGGITLDESCKILNIEENGPEMNLDKVEQRFKYLFDINDKEKGGSFYLQSKIYRAAERLKWELAQREQADKGASAHPQDQQPGPQN

pam16

Mitochondrial import inner membrane translocase subunit tim16

135 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1/sscA) via its interaction with PAM18/TIM14. May act by positioning PAM18/pamR in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

15.1 kDa

MAHRIVTQVVVTGARVFGRAFAEAYKQASAASKYQQKTGKSAGGSSSSGITLDEACKILNVKPPQAGETNLEQVMERFKKLFDLNDPQKGGSFYLQSKILRARERIEAEVREAERKAAHEKELKEGWKPKVYKDR

pam16

Mitochondrial import inner membrane translocase subunit tim16

129 amino acids

Regulates ATP-dependent protein translocation into the mitochondrial matrix.

Belongs to the TIM16/PAM16 family.

14.284 kDa

MAKYLAQIIVMGAQVVGRAFARALRQEFAASQAAAEARGQAGRQSAAASSFTGMTLQEAQQILNISTLTPEEIQKNYEHLFKVNDKAVGGSFYIQSKVVRAKERLDEELSINQQQQTKNKHADEQQQQT

pam16

Mitochondrial import inner membrane translocase subunit tim16

128 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (ssc1) via its interaction with PAM18/TIM14. May act by positioning pam18/tim14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

14.12 kDa

MSLPRAVGRFIIVGSQVMSKAFVQAYKQMIANAAQQSTGQAAASKSSTAVRRGEMTIQEAGSILNIKPESLEEGELEKRFQKMFEINDPKKGGSFYLQSKVFRAHEKLKSELDQKIQEQSPAKPTSSP

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

128 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

13.868 kDa

MAHRLLVNVIFTGASVFGRAFTEAYKQAAKATASTPQGGAAKSTSVGGIPTDEALKILDLKKTDLSVAKIDEKYAYLFDVNSKDKGNSFYLQSKVYYAMDSLRKELDYLDKLKKTKDGSQGEAGPTST

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

125 amino acids

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Belongs to the TIM16/PAM16 family.

13.825 kDa

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Pam16

Mitochondrial import inner membrane translocase subunit TIM16

125 amino acids

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity (By similarity).

Belongs to the TIM16/PAM16 family.

13.785 kDa

MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAADARGRAGHQSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELRIQAQEDREKGQKPKT

pam16

Mitochondrial import inner membrane translocase subunit tim16

125 amino acids

Regulates ATP-dependent protein translocation into the mitochondrial matrix.

Belongs to the TIM16/PAM16 family.

13.897 kDa

MAKYLAQIMVMGMQVVGRAFTRALRQEFAASRAAAEARGRAGTESAAVSSLSGISLQEAQQILNVSKLTPEEIQKNYEHLFKVNDKEVGGSFYLQSKVVRAKERLDQEMDIQSKTEKPKDETTQT

PAM16

Mitochondrial import inner membrane translocase subunit TIM16

121 amino acids

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

13.306 kDa

MAHRLLVNVIFTGASVFGRAFTEAYRQAAKASAAGAAGRPAKASSAGGIPVEEAMKILDLEKSELSLDKVEEKYEYLFNVNSKEQGNSFYLQSKVYYAMDTLKKELEYLEKLQNEKGAASN