About Products Protein Database Contact

Protein expression services for PAM16 | Mitochondrial import inner membrane translocase subunit TIM16

Description
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).
Family
Belongs to the TIM16/PAM16 family.
Species
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65)
Length
146 amino acids
Sequence
MAHRALVKIVITGTRVLGHAFAEAYRQAAAQSAAKQGASAMGRNKTGRGNAAAEYGGITLDESCKILNLDAAKDLKLDKVNQRFDYLFNINDKEKGGSFYLQSKIYRASERLKWELAQREKEAAEEKLPKAEDASEDTGEKSPPSS
Mass
16 kDa
Simulated SDS-PAGE
Western blot of PAM16 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make PAM16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here