Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation (By similarity).

Belongs to the TIM16/PAM16 family.

121 amino acids

MAHRLLVNVIFTGASVFGRAFTEAYRQAAKASAAGAAGRPAKASSAGGIPVEEAMKILDLEKSELSLDKVEEKYEYLFNVNSKEQGNSFYLQSKVYYAMDTLKKELEYLEKLQNEKGAASN

13.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PAM16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here