NTHL1

Endonuclease III-like protein 1

312 amino acids

Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines. Has also 8-oxo-7,8-dihydroguanine (8-oxoG) DNA glycosylase activity. Acts preferentially on DNA damage opposite guanine residues in DNA. Is able to process lesions in nucleosomes without requiring or inducing nucleosome disruption.

Belongs to the Nth/MutY family.

34.39 kDa

MCSPQESGMTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALCPAAQGL

NTHL1

Endonuclease III-like protein 1

305 amino acids

Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines.

Belongs to the Nth/MutY family.

33.645 kDa

MNAAGVRMVVTRARSRGTGASLRRRGEKAAPLRSGEAAAEERKSYSPVKRRRKAQRLSVAYEASEGEGGEGAEHLQAPSWQPQDWRQQLDNIRTMRSGKDAPVDQLGAEHCFDPSASPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDSTLGALIYPVGFWRSKVKYIKQTSAILQQRYDGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRRALEEWLPRELWSEINGLLVGFGQQTCLPIRPRCQACLNRALCPAARGL

Nthl1

Endonuclease III-like protein 1

300 amino acids

Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines.

Belongs to the Nth/MutY family.

33.637 kDa

MNSGVRMVTRSRSRATRIASEGCREELAPREAAAEGRKSHRPVRHPRRTQKTHVAYEAANGEEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASASPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWRNKVKYIKQTTAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHRIANRLRWTKKMTKTPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALCPAAQDL

NTHL1

Endonuclease III-like protein 1

281 amino acids

Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines.

Belongs to the Nth/MutY family.

31.915 kDa

MCAAAPRGGGRAARRLGAATAGSRVPSAAPRYSRRTRRVPIAYEAEPKPESPGPKWEPENWQQQLERIREMRRHRDAPVDEMGVDKCYDTSAPPQVMRYQVLLSLMLSSQTKDQVTSAAMLRLRQRGLTVDSILQMDDATLGQIIYPVGFWRNKVKYIKQTTAILKQKYGGDIPGTVEELVKLPGVGPKMAHLAMNIAWNSVSGIAVDTHVHRITNRLKWVKKETRYPEETRVALEDWLPRDLWREINWLLVGFGQQTCLPVNPRCKECLNQDICPTAKRF