About Products Protein Database Contact

Protein expression services for NTHL1 | Endonuclease III-like protein 1

Description
Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines.
Family
Belongs to the Nth/MutY family.
Species
Gallus gallus
Length
281 amino acids
Sequence
MCAAAPRGGGRAARRLGAATAGSRVPSAAPRYSRRTRRVPIAYEAEPKPESPGPKWEPENWQQQLERIREMRRHRDAPVDEMGVDKCYDTSAPPQVMRYQVLLSLMLSSQTKDQVTSAAMLRLRQRGLTVDSILQMDDATLGQIIYPVGFWRNKVKYIKQTTAILKQKYGGDIPGTVEELVKLPGVGPKMAHLAMNIAWNSVSGIAVDTHVHRITNRLKWVKKETRYPEETRVALEDWLPRDLWREINWLLVGFGQQTCLPVNPRCKECLNQDICPTAKRF
Mass
31.9 kDa
Simulated SDS-PAGE
Western blot of NTHL1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NTHL1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here