NIT1

Nitrilase 1

346 amino acids

Can convert indole-3-acetonitrile to the plant hormone indole-3-acetic acid.

Belongs to the carbon-nitrogen hydrolase superfamily. Nitrilase family.

38.152 kDa

MSSTKDMSTVQNATPFNGVAPSTTVRVTIVQSSTVYNDTPATIDKAEKYIVEAASKGAELVLFPEGFIGGYPRGFRFGLAVGVHNEEGRDEFRKYHASAIHVPGPEVARLADVARKNHVYLVMGAIEKEGYTLYCTVLFFSPQGQFLGKHRKLMPTSLERCIWGQGDGSTIPVYDTPIGKLGAAICWENRMPLYRTALYAKGIELYCAPTADGSKEWQSSMLHIAIEGGCFVLSACQFCQRKHFPDHPDYLFTDWYDDKEHDSIVSQGGSVIISPLGQVLAGPNFESEGLVTADIDLGDIARAKLYFDSVGHYSRPDVLHLTVNEHPRKSVTFVTKVEKAEDDSNK

NIT1

Deaminated glutathione amidase

328 amino acids

Catalyzes the hydrolysis of the amide bond in N-(4-oxoglutarate)-L-cysteinylglycine (deaminated glutathione), a metabolite repair reaction to dispose of the harmful deaminated glutathione. Plays a role in cell growth and apoptosis. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells. It is also a negative regulator of primary T-cells.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

36.24 kDa

MLGFIIRPPHQLLSLLSCPGLRIPRFSVLCAPPRLRTMAASSSFSELPLVAVCQVTSTPDKEQNFKTCAELIREAARLGACLAFLPEAFDFIARDPEETRRLSEPLSGNLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVIMNNMGSVVATYRKTHLCDVEIPGQGPMRESNSTIPGPSLESPISTPAGKIGLAICYDMRFPELSLALVQAGAEILTYPSAFGSVTGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLQQLRKQLPVFQHRRPDLYGNLGHPLS

NIT1

Deaminated glutathione amidase

327 amino acids

Catalyzes the hydrolysis of the amide bond in N-(4-oxoglutarate)-L-cysteinylglycine (deaminated glutathione), a metabolite repair reaction to dispose of the harmful deaminated glutathione. Plays a role in cell growth and apoptosis: loss of expression promotes cell growth, resistance to DNA damage stress and increased incidence to NMBA-induced tumors. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

35.896 kDa

MLGFITRPPHRFLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCELPLVAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGAVVATYRKTHLCDVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPELSLALAQAGAEILTYPSAFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS

Nit1

Deaminated glutathione amidase

327 amino acids

Catalyzes the hydrolysis of the amide bond in N-(4-oxoglutarate)-L-cysteinylglycine (deaminated glutathione), a metabolite repair reaction to dispose of the harmful deaminated glutathione. Plays a role in cell growth and apoptosis: loss of expression promotes cell growth, resistance to DNA damage stress and increased incidence to NMBA-induced tumors. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

36.094 kDa

MLGFITRPPHQLLSLLCTGYRLPQISVLCTQPRPRAMAESSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEATRLGACLAFLPEAFDFIARNPAETLLLSEPLDGDLLGQYSQLARECGIWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGSVVASYRKTHLCDVEIPGQGPMRESNYTMPGYALEPPVKTPAGKVGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWEVLLRARAIESQCYVIAAAQCGRHHETRASYGHSMVVDPWGTVVASCSEGPGLCLARIDLHFLQQMRQHLPVFQHRRPDLYGSLLPLS

Nit1

Deaminated glutathione amidase

323 amino acids

Catalyzes the hydrolysation of the amide bond in N-(4-oxoglutarate)-L-cysteinylglycine (deaminated glutathione), a metabolite repair reaction to dispose of the harmful deaminated glutathione. Plays a role in cell growth and apoptosis: loss of expression promotes cell growth, resistance to DNA damage stress and increased incidence to NMBA-induced tumors. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

35.705 kDa

MLGFITRPPHQLLCTGYRLLRTPVLCTQPRPRTMSSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEAARLGACLAFLPEAFDFIARNPAETLLLSEPLNGDLLGQYSQLARECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKGSVVASYRKTHLCDVEIPGQGPMRESNYTKPGGTLEPPVKTPAGKVGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAHWEVLLRARAIESQCYVIAAAQCGRHHETRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLHFLQQMRQHLPVFQHRRPDLYGSLGHPLS

nit1

Deaminated glutathione amidase

286 amino acids

Hydrolyzes deaminated glutathione (dGSH, 2-oxoglutaramate) to alpha-ketoglutarate (alpha-KG) and cysteinylglycine (specific activity 6.50 umol/min/mg), has less activity against alpha-ketoglutaramate (a-KGM, specific activity 0.20 umol/min/mg), very little activity on glutathione and none on L-glutamine. May function as a metabolite repair enzyme.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

31.894 kDa

MKNANVALLQLCSGENTRDNLAQIEQQIKQLNSGIQLVMTPENALLFANAASYRHHAEQHNDGPLQQEVREMARRYGVWIQVGSMPMISRESPDLITTSSLLFDSQGELKARYDKIHMFDVDIKDIHGRYRESDTYQPGEHLTVADTPVGRLGMTVCYDLRFPGLFQALRAQGAEIISVPAAFTKVTGEAHWEILLRARAIENQCVILAAAQVGRHGATRRTWGHTMAVDAWGKIIGQNPDAVSALKVKIETTGLKTIRNQMPVLQHNRFVSSLVPRLSDSKQSSK

nit1

Deaminated glutathione amidase

272 amino acids

Hydrolyzes deaminated glutathione (dGSH, 2-oxoglutaramate) to alpha-ketoglutarate (alpha-KG) and cysteinylglycine (specific activity 7.77 umol/min/mg), hydrolyzes alpha-ketoglutaramate (a-KGM, specific activity 2.13 umol/min/mg), has no activity on glutathione or L-glutamine. May function as a metabolite repair enzyme.

Belongs to the carbon-nitrogen hydrolase superfamily. NIT1/NIT2 family.

30.191 kDa

MKPYLAAALQMTSRPNLTENLQEAEELIDLAVRQGAELVGLPENFAFLGNETEKLEQATAIATATEKFLQTMAQRFQVTILAGGFPFPVAGEAGKAYNTATLIAPNGQELARYHKVHLFDVNVPDGNTYWESATVMAGQKYPPVYHSDSFGNLGLSICYDVRFPELYRYLSRQGADVLFVPAAFTAYTGKDHWQVLLQARAIENTCYVIAPAQTGCHYERRHTHGHAMIIDPWGVILADAGEKPGLAIAEINPDRLKQVRQQMPSLQHRVFV

NIT1

Putative nitrilase-like protein NIT1

199 amino acids

Belongs to the carbon-nitrogen hydrolase superfamily. Nitrilase family.

21.62 kDa

MAKHIVAALQIGSCPGSTKDTLKKILSYEKEIKESGAKLVVIPEATLGGYPKGSNFGVYLGYRLQEGREEYAKYLAEAIEIGNGEKYPEISQLCALSKATDASLCVGCIERDGTTLYCTMVYIDPKDGYVGKHRKLMPTAGERLIWGQGDGSTLPVVDTAAGKIGGAICWENMMPLLRYAMYKKGVEIWCAPTVDARPI