LTO1

Thiol-disulfide oxidoreductase LTO1

376 amino acids

Thiol-disulfide oxidoreductase catalyzing disulfide bond formation of chloroplast proteins and involved in redox regulation and photosynthetic electron transport. Required for the assembly of photosystem II (PSII) through the formation of disulfide bond in PSBO, a subunit of the PSII oxygen-evolving complex in the thylakoid lumen. Involved in the formation of disulfide bonds in the lumenal protein FKBP13. In vitro, reduces phylloquinone (vitamin K1) and menaquinone (vitamin K2) to their respective quinol. Cannot reduce phylloquinone epoxide to phylloquinone (PubMed:20626653, PubMed:21781282, PubMed:22209765, PubMed:23689258). Plays an important role in regulating the thylakoid lumen redox (PubMed:25412899).

Belongs to the VKOR family.

40.401 kDa

MMARFVSVSSCQFHFGFREVSPPSVTSYPRRFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTSNSSTYNWYTGIGGIGMLDTAYLTYLKVTGSDAFCPIGGGTCGDVLNSDYAVVFGVPLPVIGFVMYGVVTALSAELGEGNLPFGISKSNGRFALFGITTAMASASAYFLYILSTKLSGSSCLYCLVSAFLSFSLFFLSVKDVKLQEIQQVVGLQICLAIIVVASLTASYSTAQPIPSRSGDIELPYFRTEISSSSSPYAIALAKHLNSIGAKMYGAFWCSHCLEQKEMFGREAAKELNYVECFPDGYKKGTKILKACADAAIEGFPTWIINDKVLSGEIELAELAEMTGFSLDQANETNQLQ

LTO1

Protein LTO1

162 amino acids

Essential for life in oxygen, but nonessential under anaerobic conditions. Required for biogenesis of the large ribosomal subunit and initiation of translation in oxygen (PubMed:23318452). The complex LTO1:YAE1 functions as a target specific adapter that recruits apo-RLI1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery (PubMed:26182403).

Belongs to the LTO1 family.

18.896 kDa

MDFDNLLNLEEQYYQEGFLEGQNENIKQSFLEGKQYGLQVGFQRFTLLGQMEGLCDVIESYGLHSPTLEKNIHTIRTLMKGLKMNNDDESVMEFERVLIKLKNKFRTILITLHRLVKDKRTPTVTFEVFEDVSRAIAGEIRGFVENEDIAKNKTKQNQAQSW

LTO1

Protein LTO1 homolog

137 amino acids

The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery (PubMed:26182403). May be required for biogenesis of the large ribosomal subunit and initiation of translation (PubMed:23318452). May play a role in the regulation of proline metabolism and ROS production (PubMed:24930674).

Belongs to the LTO1 family.

15.354 kDa

MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF

Lto1

Protein LTO1 homolog

137 amino acids

The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery. May be required for biogenesis of the large ribosomal subunit and initiation of translation. May play a role in the regulation of proline metabolism and ROS production.

Belongs to the LTO1 family.

15.221 kDa

MAVEQDIFDAVVMADERFHGEGYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIGCYRGFALAWKCLLHSGAGEKDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQLCSLLNVQPDFKVTPGGSGLAF