Essential for life in oxygen, but nonessential under anaerobic conditions. Required for biogenesis of the large ribosomal subunit and initiation of translation in oxygen (PubMed:23318452). The complex LTO1:YAE1 functions as a target specific adapter that recruits apo-RLI1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery (PubMed:26182403).

Belongs to the LTO1 family.

162 amino acids

MDFDNLLNLEEQYYQEGFLEGQNENIKQSFLEGKQYGLQVGFQRFTLLGQMEGLCDVIESYGLHSPTLEKNIHTIRTLMKGLKMNNDDESVMEFERVLIKLKNKFRTILITLHRLVKDKRTPTVTFEVFEDVSRAIAGEIRGFVENEDIAKNKTKQNQAQSW

18.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make LTO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here