Description
The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery. May be required for biogenesis of the large ribosomal subunit and initiation of translation. May play a role in the regulation of proline metabolism and ROS production.
Family
Belongs to the LTO1 family.
Sequence
MAVEQDIFDAVVMADERFHGEGYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIGCYRGFALAWKCLLHSGAGEKDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQLCSLLNVQPDFKVTPGGSGLAF
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service