The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery. May be required for biogenesis of the large ribosomal subunit and initiation of translation. May play a role in the regulation of proline metabolism and ROS production.

Belongs to the LTO1 family.

137 amino acids

MAVEQDIFDAVVMADERFHGEGYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIGCYRGFALAWKCLLHSGAGEKDSRKMKVVEALIALLQDFPYDDPTYEKLHEDLDRIRGKFRQLCSLLNVQPDFKVTPGGSGLAF

15.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Lto1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here