egd2

Nascent polypeptide-associated complex subunit alpha

214 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

23.114 kDa

MSNPRIEELPDNEEPTKQQVTAEDEGSDSSDSEGEGEVESGIPAGAGAVVHSRNEKKARKSIAKLGLTRVPGITRVTLRRPKNILFVINNPEVYKSPTSNTYIVFGEAKIEDLNSQAQASAAAQLAAQESHDHAGHDHSGHDHSHDHGKGKAVDTGDEKKEEEEDDTEEVDATGLEDKDIELVMTQASVSRNKAVKALKENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

212 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

23.081 kDa

MSNPRIEELPDNEEPTKQQVTAEDEGSDSSDSEAEGEEVAGIPAGSQVAFSRNEKKARKSIAKLGLTRVPGITRVTLRRPKNILFVINQPEVYKSPTSNTYIVFGEAKIEDLNSQAQASAAAQLAAQESHDHAGHDHSGHDHSHDHGKGKAVDTEEKKEEEEDDTEEVDATGLEDKDIELVMTQASVSRNKAVKALKENDNDIVNSIMALSI

EGD2

Nascent polypeptide-associated complex subunit alpha

211 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

23.324 kDa

MSNPRIEELPDEPEKKNVQIEEDESSDESEGEEGEANIPAGASVAVHSRNEKKARKAIAKLGLKHIDGITRVTLRRPKNILFVINQPDVYKSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAQAEAASHDHSGHDHDHDHKGKGKAVEDKKDDEEDEEEEEEDDEEVDDSGLEAKDIELVMQQASVSRKKAVKALKENDNDIVNSIMALSI

EGD2

Nascent polypeptide-associated complex subunit alpha

209 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

23.179 kDa

MSNPRVEELPDEEPKKTTVQEHEDDSSDDSEVEEVGEGQLPAGSTVIHNRNEKKARKALEKLHLTRIPGITRVTLRRPKNILFVINTPEVYKSPNSNTYIVFGEAKIEDVNAAAQQAAAAQLASQNAEDHSGHNHGEPSKAVEADEKKEDKEDDEDEEEEEEEEVDASGLEDKDIELVMTQANVSRNKAVKALKENDNDIVNSIMALSI

EGD2

Nascent polypeptide-associated complex subunit alpha

208 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

22.216 kDa

MSSSRIEELPDDDVPKTTVEDAADSSESEVEGAEEPTIPGGAAVTVHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKGILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAGSNEHAGHDHASHDHGKGKAVESADKKDEEEDDEEVFDASGLEAKDIELVMAQASVSRNKAIKALKENDNDIVNSIMALSV

EGD2

Nascent polypeptide-associated complex subunit alpha

205 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

22.081 kDa

MANPRVEELPDEEVPKTTVEDAGESSESEAEAAEEPTIPGGAAITVHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLSAAEAAGNGEHAGHEHIDLGKGKAPETEKKEEEEEEEGEVDETGLEAKDIELVMAQANVSRSKAIKALKENDNDIVNSIMALSV

egd2

Nascent polypeptide-associated complex subunit alpha

204 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.972 kDa

MADPRVEELPDEEVPKANVEDAGSDSESEAGEESSIPAGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAAGEHAGHDHDHDHGKGKAPETEAKKEEEEDDGEEVDETGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

204 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

22.032 kDa

MADPRVEELPDEEVPKTNVEDAGSDSESEAGEESSIPSGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPTSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAAGEHAGHDHDHDHGKGKAPETEAKKEEEEDDGEEVDETGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

204 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.972 kDa

MADPRVEELPDEEVPKANVEDAGSDSESEAGEESSIPAGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAAGEHAGHDHDHDHGKGKAPETEAKKEEEEDDGEEVDETGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

203 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.972 kDa

MADPRIEELPDEEVPKTNVEDAADSSESEAGEEPTIPGGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAGEHAGHDHDHDKGKGKAPETEAKKEEEEDDGEEVDETGLEPKDIDLVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

202 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.826 kDa

MADPRVEELPDEEVPKTNVEDAGSSSESEAGDEPTIPGGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNATAQATAAQQLAEAAANEHAGHDHEHDHGKGKAPEAEAKKEEEEDDGEEVDESGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

202 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.804 kDa

MADPRVEEIVEEETPKQTVEDAGSDSESEAGEANIPAGAAVTIHSRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKIEDLNSQAQASAAQQLAAAEAAAGEHAGHDHEHDLGTKVPEAETKKEEEEDDGEPVDESGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

egd2

Nascent polypeptide-associated complex subunit alpha

202 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.912 kDa

MADPRVEELPDEEVPKTNVEDAGSDSESEAGEEPTIPGGAAVAVHSRNEKKARKAIGKLGLKLVPGITRVTFRRPKNILFVINQPEVYRSPSSNTWIIFGEAKIEDLNAQAQASAAQQLAAQEAAQEHAGHEHEDILGKAKEPEAEKKEAEEDDGEEVDESGLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI

EGD2

Nascent polypeptide-associated complex subunit alpha

201 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.82 kDa

MANPRVEELPDEEVKKTVVDDHDDDSSSDSDGEEETNLPAGSTAVIHSRNEKKARKAIEKLHLIRVDGITRVTLRRPKNILFVINNPEVYKSPNSGTYIVFGEAKIEDLNASAQAAAAQQLASSAGHDHDHAGHSHGEAKASEGDAKKEEEDDDEEVDADGIEDKDIELVMTQAGVSRTKAIKALKENDNDIVNSIMALSV

EGD2

Nascent polypeptide-associated complex subunit alpha

200 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

22.053 kDa

MADPRIEELPDEETKKPTVEELDESSDEESDAEAGDASLPAGSTAVIHSRNEKKARKAIEKLHLTRVPGITRVTLRRPKNILFVINNPEVYKSPNSNTYIVFGEAKIEDLNASAQAAAAQQLANQTAEHDHAGHTHDHKHEAAKEEEEEEDDGEEVDAEGIEDKDIELVMTQANVSRKKAIKALKENDNDIVNSIMALSV

EGD2

Nascent polypeptide-associated complex subunit alpha

198 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

21.168 kDa

MSAENKIEEITEDQVPQIEENSTIVIKKEEKAARALISKLNLQKVEGITRVVLKRTRQHIFVIANPEVYKTPTGNSYVVFGEAQHEDMQATARAAQIAAAQAQQAAAETGSVSEAAAAGEVGAELASKDPASITADLEAASLSKDEDAEDEAEADATGLEDSDIKLVMEQANVSRNKAINGLKKNDSDVVNTIMDLCK

EGD2

Nascent polypeptide-associated complex subunit alpha

191 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

20.275 kDa

MSIENLHIADETEIPAGATVELHSRPERKARKALEGLGLKRVQGIQRVTLRRARNVLLVVSSPEVYKSPGSDCYIVFGEAKVEDPNSAAQLQAQAQLAASSQAAQQAHAHGGFKEGVPKSLEELMQDAPSADSSAPAPSGEATDASASGDFKVSDEEIQLIVAQTGVDEAKAREAYISEKGDLINAIMKLQ

EGD2

Nascent polypeptide-associated complex subunit alpha

191 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

20.305 kDa

MSIENLHIADETEIPAGATVELHSRPERKARKALEGLGLKRVQGIQRVTLRRARNVLLVVSSPEVYKSPGSDCYIVFGEAKVEDPNSAAQLQAQAQLAASSQAAQQAHAHGGFKEGVPKSLEELMQDAPSTDSSAPAPSGEATDASASGDFKVSDEEIQLIVAQTGVDEAKAREAYISEKGDLINAIMKLQ

EGD2

Nascent polypeptide-associated complex subunit alpha

190 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

20.651 kDa

MSATVEEIADDVQDLNVQEFDSDDAGADVHASDKVASRAERKSRKALQGIGLKKVGGITRVTMRRPRGHLYVIAQPEVYKSSHSDVYIVFGEAKAEDMSQLAQAQAAQQMAQAEAQERLLAESLQNSSASGAEKKVEEEEEDDDSPIDEEGVDAKDIDLVMQQVSCSRRKAVKALKESNGDLINAIMNAS

EGD2

Nascent polypeptide-associated complex subunit alpha

182 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

19.552 kDa

MSIEEIPQGADVSIVPNKNEKKAKELIKKLGLKQIKGISRVTFKQRGNLIYAIDAPEVYRSQAGTYVVFGEAKVDDMNQRIAEAQAQQAQQEALQKAAADAGAAGDDKSPEAITADLEKASLQGGESNADAAEDDNEEVDETGINPKDIDLIVEQTRVSRGSAVKALKKHDGDMVNALMELS

EGD2

Nascent polypeptide-associated complex subunit alpha

180 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

19.706 kDa

MSIEEIPQGADVSILSKNEKKARELIKKLNLKQIKGITRVTFKQRGNLIYAIDQPDVFRSSAGTYVVFGEAKVDDMNKRIAEAQQQQAQQDALSKAAGETGEAGEEDKSQDAITADLEKASLNTNKIEEEEADDGEVDESGLDAKDIDIIVEQTQVSRAKAVKALRVHDGDMVNAIMELS

EGD2

Nascent polypeptide-associated complex subunit alpha

178 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

19.548 kDa

MSIEEIPEEIPQGADVTILSKNEKKARELIKKLHLKPVPGITRVTFKQKGNLIYAIEQPDVFKSAAGTYVVFGEAKVDDMNKRIAEAQAQQEQQEALTKAAADAETADKSPESITNDLQNASLEDKTVEEDEGEVDETGLDSKDIEIIVEQTQVSRAKAVKALRAHKGDMVNAIMELS

EGD2

Nascent polypeptide-associated complex subunit alpha

178 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

19.51 kDa

MSIEEIPQGADVNVIPKNEKKARELIKKLNLKQIKGISRVTFKQRGNLIYAIDSPDVYRSAAGTYVVFGEAKVDDMNQRIAEAQAQQAQQEALQKAAADAGKTEDKSPEAITADLEKASLGDKKAEDEEEDEGEIDETGLDPKDIEIVVEQTQVSRAKAVKALRNHDGDMVNAIMDLS

EGD2

Nascent polypeptide-associated complex subunit alpha

176 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

19.309 kDa

MSIEEIPQGADVNVIPKNEKKARELIKKLNLKQIKGITRVTFKQRGNLIYAIDAPDVYRSAAGTYVVFGEAKVDDMNQRIADAQAAQAAETDAHAGHTHSHGEEDKSPEAITADLEKASLTEKIEEEEEEGEVDESGLDAKDIDIIVEQTQVSRAKAVKALRKHDGDMVNAIMELS

EGD2

Nascent polypeptide-associated complex subunit alpha

176 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

18.86 kDa

MSEIAQDSNVSIFSKNEKKARELILKLGLKPIQGVSRVTFKKKDGQIFAIDRPEVYKSQGGNFVVFGEAKVDDFTQRLAKAQESLQQNEGVLPAGQDAVSKDPQSIQADMQAAADSATDKPSADDAVDDAEVDETGLNADDIELVMQQAGVPRAKAAKALKEHDSDIVNAIMALSG

EGD2

Nascent polypeptide-associated complex subunit alpha

174 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

18.709 kDa

MSAIPENANVTVLNKNEKKARELIGKLGLKQIPGIIRVTFRKKDNQIYAIEKPEVFRSAGGNYVVFGEAKVDNFTQKLAAAQQQAQASGIMPSNEDVATKSPEDIQADMQAAAEGSVNAAAEEDDEEGEVDAGDLNKDDIELVVQQTNVSKNQAIKALKAHNGDLVNAIMSLSK

EGD2

Nascent polypeptide-associated complex subunit alpha

174 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation.

Belongs to the NAC-alpha family.

18.709 kDa

MSAIPENANVTVLNKNEKKARELIGKLGLKQIPGIIRVTFRKKDNQIYAIEKPEVFRSAGGNYVVFGEAKVDNFTQKLAAAQQQAQASGIMPSNEDVATKSPEDIQADMQAAAEGSVNAAAEEDDEEGEVDAGDLNKDDIELVVQQTNVSKNQAIKALKAHNGDLVNAIMSLSK

egd2

Nascent polypeptide-associated complex subunit alpha

173 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Ucp15 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

18.785 kDa

MSVESQPVEKISELPAGSTTVVHAEKAQKLIQKLGLKRVEGITRVAMRRPKNILLIINEPIVYKSSNNAYIVLGKVTVEDMAAQARAFNESQKQATETKEEAAITEESGDAQPADTAKIEESFEQEKAVDETGVDAKDIELVMAQANVSRAKAVTALKENNSDVVNAIMSLTM

EGD2

Nascent polypeptide-associated complex subunit alpha

169 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

18.185 kDa

MSAIPEGSNVTVLNKNEKKAREMISKLGLKKIAGINRVTFRKKDNQIFAIDNPEVYRSQGGNYVVFGEAKIDNFSQKLAAAQEKIQSVSKSPEEIQKDMQLAADQAGDESAKPAAAAEEDDEAPVDAGDLSAEDIELVASQANVSKNKAIKALKEHNGDIVNAIMALSK

EGD2

Nascent polypeptide-associated complex subunit alpha

168 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

18.217 kDa

MSEIPENSKVSIYSKNEKKARELIQKFSMKPMPGITRVTFRKKNNQIFAIDNPDVYKTQGGNYVVFGEPKVDDFTRRLARAQQQAASAAKDPQSIQADMAAAAAAPAAPAAPAAAPEEDEAGQVDESGLDGQDIELVMQQANVSRNKAVKALREHNSDIVNAIMSLSK

EGD2

Nascent polypeptide-associated complex subunit alpha

165 amino acids

Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

17.894 kDa

MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKDNQIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQAAAVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAIMSLSK

EGD2

Nascent polypeptide-associated complex subunit alpha

157 amino acids

May be involved in mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

17.517 kDa

MARALTTDESHIHKTLGAKVGLEEVEAVERIAIVVKDTRYSVESPVAYRIKGTDSILIFGDLGSPVNLHQLKRMYEDSIRSSKDQEGPGLYDEIHSDPQEDGVKEAEEITVDPSDERLSEEDIKLISSQVKASRNDIIKALVESEYDVVDAMMKLTK