May be involved in mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).

Belongs to the NAC-alpha family.

157 amino acids

MARALTTDESHIHKTLGAKVGLEEVEAVERIAIVVKDTRYSVESPVAYRIKGTDSILIFGDLGSPVNLHQLKRMYEDSIRSSKDQEGPGLYDEIHSDPQEDGVKEAEEITVDPSDERLSEEDIKLISSQVKASRNDIIKALVESEYDVVDAMMKLTK

17.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make EGD2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here