About Products Protein Database Contact

Protein expression services for EGD2 | Nascent polypeptide-associated complex subunit alpha

Description
Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).
Family
Belongs to the NAC-alpha family.
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294)
Length
169 amino acids
Sequence
MSAIPEGSNVTVLNKNEKKAREMISKLGLKKIAGINRVTFRKKDNQIFAIDNPEVYRSQGGNYVVFGEAKIDNFSQKLAAAQEKIQSVSKSPEEIQKDMQLAADQAGDESAKPAAAAEEDDEAPVDAGDLSAEDIELVASQANVSKNKAIKALKEHNGDIVNAIMALSK
Mass
18.2 kDa
Simulated SDS-PAGE
Western blot of EGD2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make EGD2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here