Description
Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. EGD2 may also be involved in transcription regulation (By similarity).
Family
Belongs to the NAC-alpha family.
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294)
Sequence
MSAIPEGSNVTVLNKNEKKAREMISKLGLKKIAGINRVTFRKKDNQIFAIDNPEVYRSQGGNYVVFGEAKIDNFSQKLAAAQEKIQSVSKSPEEIQKDMQLAADQAGDESAKPAAAAEEDDEAPVDAGDLSAEDIELVASQANVSKNKAIKALKEHNGDIVNAIMALSK
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service