DPH5

Diphthine methyl ester synthase

300 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

34.213 kDa

MLYLIGLGLSYESDITVRGLETIKKCKRVYLEAYTSILMAANQESLEAFYGREIILADRELVEGGSDKILENADEDDVAFLVVGDPFGATTHTDLIIRARELNIKVEAIHNASVMNAVGACGLQLYQFGQTVSLVFFTETWKPDSFYNKIMENRRIGLHTLLLLDIKVKEQSIENMARGKLIYEPPRYMNIETAASQLLEIEEMRQEKAYTPNTPCVAISRLGSPEQTFKAGTLQELSEYDSGEPLHSLVMLGRQVHDLELEYLYEYVDNKEQFKKFVEEDQEFFKPPPYVPPEDENLSE

DPH5

Diphthine methyl ester synthase 1

299 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

33.899 kDa

MLYLIGLGLSYESDITVRGLETVKKCKRVYLEAYTSILMAANQESLEKFYGREIILADRELVETGSDDILKDADKEDVAFLVVGDPFGATTHTDLVIRARELGIKVETIHNASVMNAVGACGLQLYQFGQTVSLVFFTDSWKPDSFYGKIMENRKIGLHTLLLLDIKVKEQSIENMARGRLIYEPPRYMDIATAAQQLLEIESIRQEQAYTPNTPCVAISRLGSPTQTFKAGTLQELSEYDSGEPLHSLVMLGRQVHELELEYLYQFVDDKEKFKKFVEQDQEFFKPAPYVPPEDVDSE

DPH5

Diphthine methyl ester synthase

298 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

33.768 kDa

MLFLVGLGLSSHEDITVRGLNAVKRCARVYLEHYTSILMTASKEELEGFYGKPVVLADREMVESGCEEILRDADKEDVAFLVVGDPFGATTHTDLVLRAKKQGIVVEVVHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVLENRRIGLHTLVLLDIKVKEQSPENLARGRLIFEPPRYMSISQCCEQLLEVEEKRGQQAYTPDTPCVAISRLGAPTQHMKSGSIHELAEYDAGEPLHSLVILGRQCHELELEYLLEFSEDQERFKDQVHRDQEFFKPAPWVPPPEDED

DPH5

Diphthine methyl ester synthase

298 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

33.705 kDa

MLYLIGLGLSYKSDITVRGLEAVKNCTRVYLEHYTSILMAASKEELEEFYGKEVILADRELVESGSADILRDADKENVAFLVVGDPFGATTHTDLVLRAKKDKIPVEVIHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVMENRKIGLHTLVLLDIKVKEQSLENMARGRLIYEPPRYMSIAQCCQQLLEIEELRAEKAYTADTPVVGISRLGSPTQSFKAGTIKELAEYDAGEPLHSLVILGRQSHELELEYLLEFTDNKEKFKNDVIADQEYFKPAPWVPPVEEED

DPH5

Diphthine methyl ester synthase

298 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

33.909 kDa

MLYFIGLGLSYETDITVRGLNAIKQCSRVYLEHYTSILMTASLEELEEFYGKKVTLADRELVESGAEELLRDADKEDVAFLVVGDVFGATTHTDLVLRAKQRNIPVEVIHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKIWENRKIGLHTLVLLDIKVKEQSIENMARGRLIYEPPRYMSIAQCCEQLLEIEETRGTEAYTPDTPCVAISRLGSASQTFKAGTIKELAEYDSGEPLHSLVILGRQTHELEIEYLLEFCDDREKFKQDVASDQEYFKPPAWVPPPEDED

DPH5

Diphthine methyl ester synthase

287 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

32.32 kDa

MLYLVGLGLSDETDITVKGLEVVKKASRVYLEAYTSILLVEQSVLESYYGRSITVADREMVESNSEEILRNAQNEDVAFLVVGDPFGATTHTDLVLRARELEIPVRTVPNASIMSGIGACGLQLYNFGQTVSMVFFTDTWKPASFYDRIKENRQIGLHTLVLVDIKVKEQSLENMARGRLVYEPPRYMTVGQCAQQMLEIEEERKEGVYAKDSLAIGAARVGGRTEKFVAGTLEELCSTDEELGPPLHSLVLLGRRTHELELDYVRQFAVDKEKWDKIWNAEYGKQL

dph5

Diphthine methyl ester synthase

285 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.49 kDa

MLYLVGLGLADETDITVKGLEVVKRAERVYLEAYTSILLVSKEKLEAFYGRPVIEADRELVETGSDEILAGADKADVAFLVVGDPFGATTHTDLVLRAREMGIESKVIPNASIMSGIGCTGLQLYNFGQTVSMVFFTENWKPTSYYDRVKENVQLGLHTLVLLDIKVKEQSYENMARGRRIFEPPRYMTVAQCASQMLETEEERKEGVFGPDSLAVGAARVGGPDQKLVVGTLKELSEVDMGPPLHSLVLLGRKAHDLERLYIREFAVDKATFDASWNKGYGATS

DPH5

Diphthine methyl ester synthase

285 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.662 kDa

MLYMIGLGLGDAKDITVKGLEVVRRCSRVYLETYTSVLTVGKEVLEEFYERKLILADREEVEQEADNILKDADISDVAFLVVGDPFGATTHSDLILRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGAEDQKIAAGTLQQMSTVDLGGPLHSLIITGGSLHPLEMEMLSLFTIPENSSEAQSIGGL

dph5

Diphthine methyl ester synthase

285 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.602 kDa

MLYLVGLGLADERDITVRGLEVVKKAERVYLEAYTAILLVDKAKLEAFYGRPVIEADRELVETGSDDILANADKVDVAFLVVGDPFGATTHTDLVLRARELGIESKVIPNASIMSGIGCTGLQLYNFGQTVSMVFFTETWKPSSYYDRVKENVQIGLHTLVLLDIKVKEQSLENMARGRLIYEPPRFMTVAQCAAQMLETEEERQEGVWGPDSLAVGAARVGAEDQKLVAGTLQELTQVDMGRPLHSLVLLGRRAHDLEKDYIRRFAVDEATFDAAWQNGKYGSS

DPH5

Diphthine methyl ester synthase

285 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.651 kDa

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREEVEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSINGL

Dph5

Diphthine methyl ester synthase

281 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.218 kDa

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREEVEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIMNAVGCCGLQLYRFGETVSIVFWTDTWRPESFFDKVKRNRANGMHTLCLLDIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQQLLEIVQNHRARGEEPAITEETLCVGLARVGAEDQKIAAGTLQQMCTVSLGEPLHSLVITGGNLHPLEMEMLSLFSIPESQSTDGL

dph5

Diphthine methyl ester synthase

273 amino acids

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

31.016 kDa

MVLYIIGLGLGDEKDVTIKGFEAIKKSSKIYLEAYTSLLGGSTSIEALEKFYEKKIIIADREMVESGCEEMLKESTENDVSFLVVGDPFGATTHTDLVIRAKELSIPVKVIHNASIMNAIGCCGLQLYSYGQTISMVFFTETTKPDSWYDRVKINRVNGMHTLCLLDIKVKEQSIENMCRGRLIYEPPRFMTVNQCIEQLLEIEEIRKEKVYDQDTLCIGLSRVGQDDQQIISGTMKELLDVDFGAPLHSFIICGDMHFIEKEYFETFRVKKN