S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.

Belongs to the diphthine synthase family.

285 amino acids

MLYLVGLGLADERDITVRGLEVVKKAERVYLEAYTAILLVDKAKLEAFYGRPVIEADRELVETGSDDILANADKVDVAFLVVGDPFGATTHTDLVLRARELGIESKVIPNASIMSGIGCTGLQLYNFGQTVSMVFFTETWKPSSYYDRVKENVQIGLHTLVLLDIKVKEQSLENMARGRLIYEPPRFMTVAQCAAQMLETEEERQEGVWGPDSLAVGAARVGAEDQKLVAGTLQELTQVDMGRPLHSLVLLGRRAHDLEKDYIRRFAVDEATFDAAWQNGKYGSS

31.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dph5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here