COI

Cytochrome c oxidase subunit 1

698 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

81.747 kDa

MLYIFNSFDNMWVDFIEQTKSFKVSVNNYFYYLNKIKKLFTYLNDLRKHILKKYVYTINHKRIAINYLYFSMVTGLSGAALATMIRMELAHPESPFFKGDSLRYLQVVTAHGLIMVFFVVVPILFGGFANFLIPYHVGSKDVAYPRLNSIGFWIQPCGYILLAKIGFLRPQFWRYYDKTSFSFPFLEKMKYNQYKEYKNDYLFYLDFLKKEITDDHSFFWKARKVIKLPQYSVFSFVPLKLMMWKTMINYPESFWYAASRVVQSRRKKVFVTKCSARTLTTAGWTFITPFSSNIKYTGVGSQDILILSVVFAGISTTISFTNLLITRRTLAMPGMRHRRVLMPFVTISIFLTLRMLATITPVLGAAVIMMAFDRHWQTTFFEYAYGGDPILSQHLFWFFGHPEVYVLIIPTFGFINMIVPHNNTRRVASKHHMIWAIYVMAYMGYLVWGHHMYLVGLDHRSRTMYSTITIMISMPATIKVVNWTLSLVNGALKVDLPFLFSMSFLLLFLVAGFTGMWLSHVSLNVSMHDTFYVVAHFHIMLSGAAITGIFSGFYYYFNALFGIKFSRMFGYMHLIYYSGGQWVAFVPQFYLGFSGMPRRIHDYPVVFMGWHSMSTAGHFITLIGIMFFFLMIFDSHIERRAATSSTLGLPRWYKRISYYIFKIRYLQHNKAKMNGIPGSTVRLMLIDRHFAEFEVFKK

COI

Cytochrome c oxidase subunit 1

698 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

81.747 kDa

MLYIFNSFDNMWVDFIEQTKSFKVSVNNYFYYLNKIKKLFTYLNDLRKHILKKYVYTINHKRIAINYLYFSMVTGLSGAALATMIRMELAHPESPFFKGDSLRYLQVVTAHGLIMVFFVVVPILFGGFANFLIPYHVGSKDVAYPRLNSIGFWIQPCGYILLAKIGFLRPQFWRYYDKTSFSFPFLEKMKYNQYKEYKNDYLFYLDFLKKEITDDHSFFWKARKVIKLPQYSVFSFVPLKLMMWKTMINYPESFWYAASRVVQSRRKKVFVTKCSARTLTTAGWTFITPFSSNIKYTGVGSQDILILSVVFAGISTTISFTNLLITRRTLAMPGMRHRRVLMPFVTISIFLTLRMLATITPVLGAAVIMMAFDRHWQTTFFEYAYGGDPILSQHLFWFFGHPEVYVLIIPTFGFINMIVPHNNTRRVASKHHMIWAIYVMAYMGYLVWGHHMYLVGLDHRSRTMYSTITIMISMPATIKVVNWTLSLVNGALKVDLPFLFSMSFLLLFLVAGFTGMWLSHVSLNVSMHDTFYVVAHFHIMLSGAAITGIFSGFYYYFNALFGIKFSRMFGYMHLIYYSGGQWVAFVPQFYLGFSGMPRRIHDYPVVFMGWHSMSTAGHFITLIGIMFFFLMIFDSHIERRAATSSTLGLPRWYKRISYYIFKIRYLQHNKAKMNGIPGSTVRLMLIDRHFAEFEVFKK

COI

Cytochrome c oxidase subunit 1

645 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

74.037 kDa

MNHKRIALNYFYFSMWTGLSGAALATMIRLEMAYPGSPFFKGDSIKYLQVATAHGLIMVFFVVVPIFFGGFANFLIPYHVGSKDVAFPRLNSIGFWIQPLGFLLVAKIAFLRTTSWKYYDKTSFFLQPYNKSLYRDFFNFLTGELSFNPFKKSLDESLFLFLWKPRKKITNTEYTSFFFNPLNLSFLDSFFYYSDNLWSLANKVVSSRRKKIYVTKCSNRAAVTAGWTFITPFSSNMKYSGFGAQDVLSVAVVLAGISTTISLLTLITRRTLVAPGLRNRRVLIPFITISLLLTLRLLAIVTPILGAAVLMSLMDRHWQTSFFDFAYGGDPILFQHLFWFFGHPEVYILIIPSFGVANIVLPFYTMRRMSSKHHMIWAVYVMAYMGFVVWGHHMYLVGLDHRSRNIYSTITIMICLPATIKLVNWTLTLANAAIHVDLVFLFFCSYVFFFLTGGFTGMWLSHVGLNISVHDTFYVVAHFHLMLAGAAMMGAFTGLYYYYNTFFDVQYSKIFGFLHLVYYSAGIWTTFFPMFFLGFSGLPRRIHDFPAFFLGWHGLASCGHFLTLAGVCFFFFGIFDSTSENKSSILANFGIPKIAKRAHLYFFKISYNNYTNEIASELPKVEVRKFIIENTFGEYECVKLVPVTK

COI

Cytochrome c oxidase subunit 1

551 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

61.644 kDa

MMKMLKKEEMGGYGEVESWWRRWLWSTNHKDIGTLYLYSGVWGGLFGASLSLMIRMQLGHPGAVFLKSDWFYNVVVTTHALMMIFFAVMPILIEAFGNWLIPLLVGGKDMIYPRMNNLSYWLSPNALYLLMLSFSTDKGVGAGWTIYPPLSVYPYHSGPSMDVLIVSLHLAGLSSLVGAINFASTNKNMPVLEMKGERAELYVLSISVTAVLLIISIPVLGGGITMILFDRNFNTTFFDPAGGGDPVLFQHLFWFFGHPEVYILILPAFGVMSKVIMHCSGKEAVFGLIGMVYAMIGIGGLGCMVWAHHMFTVGLNVDTRGYFSTATMVIAVPTGVKVFSWLATMAGSKFKMKPAAYWSTGFLFLFTVGGLTGVLLSSASMDVSLHDTYYVVAHFHYVLSMGAVFGVFCGLNHWLPNFVGVCFNKKWSKAHFMAMFFGVNTTFFPQHFLGLSGMPRRYMDYADIYAHWHWVSSYGSAVSFGSLMYFKFLLWEALVSQRGVVFSGGLCGEMDWAGTRDLYPGSKHVYSQLPFVWTNPYNTCITYIYKKSRNQ

COI

Cytochrome c oxidase subunit 1

549 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

63.272 kDa

MFWLCLVCLSVSHKMIGLCYLLVAILSGFVGYVYSLFIRLELSLIGCGILFGDYQFYNVLITSHGLIMVFAFIMPVMMGGLVNYFIPVMAGFPDMVFPRLNNMSFWMYLAGFGCVVNGFLTEEGMGVGWTLYPTLICIDFHSSLACDFVMFAVHLLGISSILNSINLLGTLFCCRRKFFSFLSWSLFIWAALITAILLIITLPVLAGGVTLILCDRNFNTSFYDVVGGGDLILFQHIFWFFGHPEVYIILLPVFGLISTIVEVIGFRCVFSTVAMIYSMILIAILGMFVWAHHMFVVGMDVDSRAYFGGVSILIGLPTCVKLFNWIYSFLYTDMIITFEVYFVIMFIFMFLIGAVTGLFLSNVGIDIMLHDTYFVVGHFHYVLSLGAVVGFFTGFIHFLAKWLPIELYLFWMFYFISTLFIGSNMLFFPMHSLGMYAFPRRISDYPVSFLFWSSFMLYGMLLLASLILFLCALFCVFLFWDYCLFFVSLFVFSLYCFFYFSTWLPCVMVLYLLLVDFAHIVLDYLFLILCFCFVFFIFFWQSLFLFFYI

COI

Cytochrome c oxidase subunit 1

541 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

59.737 kDa

MSGGVSLWIERWMLSTNAKDIGNLYLIFALFSGLLGTAFSVLIRMELSGPSVQYIADNQLYNSIITAHALLMIFFMVMPALIGGFGNFLLPLLVGGPDMAFPRLNNISFWLLPPSLILLVFSACIEGGAGTGWTIYPPLSGVQSHSGPSVDLAIFALHLSGVSSLLGAMNFITTIMNMRTPSIRLHKLALFGWAVIITAVLLLLSLPVLAGAITMLLTDRNFNTSFFETAGGGDPILFQHLFWFFGHPEVYILIIPAFGIISTTISAYSNKSVFGYIGMVYAMMSIGILGFIVWSHHMYTVGLDVDTRAYFTAATLIIAVPTGIKIFSWLATCYGGSIRLTPSMLFALGFVFMFTIGGLSGVVLANASLDIAFHDTYYVVAHFHYVLSMGAVFAMFSGWYFWIPKMLGLNYNMTLSKVQFWILFIGVNVTFFPQHFLGLQGMPRRISDYPDAFAGWNLISSFGSIISVVAAWLFLYIVYLQLVEGEYAGRFPWLNPQFYTDTLQALLNRSYPSLEWALSSPPKPHAFVSLPLQSNILRSLF

COI

Cytochrome c oxidase subunit 1

530 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

58.77 kDa

MDNKFLTRWVFSTNHKDIGTLYLVFGIGSGMIGTALSMLIRLELSAPGTMLGDDHLYNVIVTAHAFIMIFFLVMPVMIGGFGNWLVPLYIGAPDMAFPRLNNISFWLLPPALILLLGSAFVEQGVGTGWTVYPPLSAIQAHSGGAVDMAIFSLHLAGASSILGAMNFITTIFNMRAPGMTMDRLPLFVWSILITAFLLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILFQHLFWFFGHPEVYILILPGFGMVSQIIPTFSAKNQIFGYLGMVYAMLSIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWLATIYGGAVRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDIVLHDTYYVVAHFHYVLSMGAIFAIFAGFYFWFGKITGYCYNELYGKIHFWIMFIGVNLTFFPQHFLGLAGFPRRYSDFVDGFAGWNLVSSLGSTISIVGVIWFVFIVYDAYVREIKFIGWVENTGASWSSLEWVQPSPPMSHTYNELPFVYGSYSALRPRNS

COI

Cytochrome c oxidase subunit 1

525 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

58.529 kDa

MSGFYKYQGGLSVWLESSNHKDIGTLYFLFGLWSGMVGTSLSLVIRLELAKPGLLLGSGQLYNSVITAHAILMIFFMVMPTMIGGFGNWMLPLMLGAPDMSFPRLNNLSFWLLPTAMFLILDACFVDMGCGTSWTVYPPLSTMGHPGGSVDLAIFSLHCAGVSSILGAINFMTTTKNLRSSSISLEHMSLFVWTVFVTVFLLVLSLPVLAGAITMLLTDRNLNTSFFDPSTGGNPLIYQHLFWFFGHPEVYILILPAFGIISQSSLYLTGKKEVFGSLGMVYAILSIGLIGCVVWAHHMYTVGMDLDSRAYFTAATMVIAVPTGVKVFSWLATLFGMKMVFQPLLLWVMGFIFLFTIGGLTGVMLSNSSLDIILHDTYYVVSHFHYVLSLGAVFGIFTGVTLWWSFITGFVYDKMMMSSVFVLMFVGVNLTFFPLHFAGIHGYPRKYLDYPDVYSVWNIMASYGSMISVFALFLFIYVLLESFVGHRIFLFDYYVNSGPEYSLSGYVFGHSYQSEIFYSSIVFKF

COI

Cytochrome c oxidase subunit 1

521 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

59.294 kDa

MMKWFMSTNHKNIGILYIILALWSGMLGSSMSLIIRMELSSPGSWISNDQIYNTIVTSHAFLMIFFMVMPFLIGGFGNWLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPGTGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSIMGSLNLMVTIMMMKNFSMNYDQISLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFGHPEVYILILPGFGLISHIVMNESGKKEIFGNLSMIYAMLGIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAVPTGIKVFSWLATYHGSKLKLNISILWSLGFIMLFTIGGLTGIMLSNSSIDIILHDTYYVVGHFHYVLSMGAVFAIISSFIHWYPLITGLLLNIKWLKIQFIMMFIGVNLTFFPQHFLGLMSMPRRYSDYPDSYYCWNSISSMGSMISLNSMIFLIFIILESLISKRMLLFKFNQSSLEWLNFLPPLDHSHLEIPLLIKNLNLKSILIKF

COI

Cytochrome c oxidase subunit 1

517 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.238 kDa

MQLSRWLFSTNHKDIGTLYLIFGAWAGMIGTAMSVIIRTELAQPGSLLQDDQIYNVIVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGVESGTGTGWTIYPPLSSGLAHAGGSVDLAIFSLHLAGASSILASINFITTIINMRTPGMSFDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGHPEVYILILPGFGMISHVIAHYAGKNEPFGYLGMVYAIISIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWMATLQGSNLRWDTPLLWALGFVFLFTIGGLTGVVLANSSIDIILHDTHYVVAHFHYVLSMGAVFAIFAGFTHWFPLFSGVSLHPLWSKVHFAVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSTISLIRTLIFLFLIWEAFSTKRTPIHPEFSSSSLEWQYPSFPPSHHTFDETPSAVYLIK

COI

Cytochrome c oxidase subunit 1

517 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.306 kDa

MQLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRAELAQPGSLLNDDQIYNVVVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFILLLASAGVENGAGTGWTIYPPLSSNITHAGSSVDLAIFSLHLAGASSILGLINFITTIINMRTPGMSLDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWLFGHPEVYILILPGFGMISHVIAHYSGKREPFGYLGLVYAMIAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGLKVFSWMAKLQGSNLQWSLPLLWTLGIVFLFTLGGLTGIVLANSSIDFVLHDTYYVVAHFHYVLSMGAVFAIFAGFTHWFPLFSGYSLHPLWGKVHFFIMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTISSIGSTISVVAMLFFLFLIWEAFASQREGITPEFSHASLEWQYTSFPPSHHTFDETPSTIIIVK

COI

Cytochrome c oxidase subunit 1

517 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.306 kDa

MQLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRAELAQPGSLLNDDQIYNVVVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFILLLASAGVENGAGTGWTIYPPLSSNITHAGSSVDLAIFSLHLAGASSILGLINFITTIINMRTPGMSLDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWLFGHPEVYILILPGFGMISHVIAHYSGKREPFGYLGLVYAMIAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGLKVFSWMAKLQGSNLQWSLPLLWTLGIVFLFTLGGLTGIVLANSSIDFVLHDTYYVVAHFHYVLSMGAVFAIFAGFTHWFPLFSGYSLHPLWGKVHFFIMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTISSIGSTISVVAMLFFLFLIWEAFASQREGITPEFSHASLEWQYTSFPPSHHTFDETPSTIIIVK

COI

Cytochrome c oxidase subunit 1

517 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.217 kDa

MQLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRAELAQPGSLLNDDQIYNVVVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFILLLASAGVESGAGTGWTIYPPLSSNIAHAGGSVDLAIFSLHLAGASSILASINFITTIINMRTPGMSFDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGHPEVYILILPGFGMISHVIAHYSGKREPFGYLGMVYAMIAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWMATLQGSNLQWETPLLWALGFVFLFTLGGLTGIVLANSSIDVVLHDTYYVVAHFHYVLSMGAVFAIFAGFTHWFPLFCGYNLHPLWGKAHFFMMFVGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSTISLVAMLFFIFLIWEAFASQREGVTPEFANASLEWQYNSFPPSHHTFDETPSTVVIVK

COI

Cytochrome c oxidase subunit 1

517 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.035 kDa

MQLSRWFFSTNHKDIGTLYLIFGAWAGMAGTAMSVIIRTELAQPGSLLQDDQIYNVIVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGVESGAGTGWTIYPPLSSGLAHAGGSVDLAIFSLHLAGASSILASINFITTVINMRTPGISFDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGHPEVYILILPGFGMISHVIAHYAGKSEPFGYLGMVYAIVSIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSWMATLQGSNLRWDTPLLWALGFVFLFTIGGLTGVILANSSIDVILHDTYYVVAHFHYVLSMGAVFAIFAGFTHWFPLFSGVGLHPLWGNIHFTLMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTLWNTVSSIGSTISLIATLVFLFILWEAFTSQRTALQPEFSTSSLEWQYSSFPPSHHTFDEIPSTVYLIK

COI

Cytochrome c oxidase subunit 1

514 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity).

Belongs to the heme-copper respiratory oxidase family.

57.395 kDa

MSRKWLYSTNHKDIGTLYFIFGIWSGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGITSILGAINFITTIINMRINGMSFDQMPLFVWSVGITALLLLLSLPVLAGAFTMLTTDRNLNTSFFDPAGGEILFYIQHLFWFFGHPEVYILILPGFGMISMLFHKKEEKKKHFGSLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSILWSLGFVFLFTVGGLTGVVLANPSIDIALHDTYYVVAHFHYVLSMGAVFAIIAGFIHWYPLFTGLSLNPYFLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYISWNIISSLGSYISLLAVMLILIIIWESMINQRMILFSLNLTSSMEWYKSKLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

514 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

56.841 kDa

MSRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGAFIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWMLPPSLTLLISSSMVENGAGTGWTVYPPLSSGIAHAGASVDLAIFSLHLAGISSILGAVNFITTVINMRSPGITLDRMPLFVWSVVITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIITQESGKKETFGNLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLTYSPAMLWAFGFVFLFTVGGLTGVVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWYPLLTGLTMNPTWLKIQFSIMFVGVNLTFFPQHFLGLAGMPRRYSDFPDSYLTWNVVSSLGSTISLFAILYFLFIIWESMITQRTPAFPMQLSSSIEWYHTLPPAEHTYAELPLLTNNF

COI

Cytochrome c oxidase subunit 1

514 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

56.871 kDa

MSRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGAFIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWMLPPSLTLLISSSMVENGAGTGWTVYPPLSSGIAHAGASVDLAIFSLHLAGISSILGAVNFITTVINMRAPGITLDRMPLFVWSVVITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGEPNLYQHLFWFFGHPEVYILILPGFGMISHIITQESGKKETFGNLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATMHGTQLTYSPAMLWAFGFVFLFTVGGLTGVVLANSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLLTGLTMNPNWLKLQFAMMFVGVNLTFFPQHFLGLAGMPRRYSDFPDSYLAWNIVSSLGSTISLFAILYFLFIIWESMITQRTPAFPMQLSSSIEWYHTLPPAEHTYAELPLLTNNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.133 kDa

MVRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRVELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLTLNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSFIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.033 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLVATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.033 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLVATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.047 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.133 kDa

MVRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRVELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLTLNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSFIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.033 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLVATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.033 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLVATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.047 kDa

MMRKWLYSTNHKDIGTLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAVNFITTIINMRPNNMSLDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLALNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDTYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

513 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

56.809 kDa

MRWFYSTNHKDIGTLYFILGVWAGMVGAGMSLLIRIELSQPGAFLGSDQLYNTIVTAHXFVMIFFLVMPVFIGGFGNWLLPLMLGAPDMAFPRLNNMSFWLLPPSLILLVSSAAVEKGAGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGASSILGAINFITTVINMRWSGLRLERIPLFVWAVLITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGAISHIVSHYTAKLEPFGALGMIYAMLGIAVLGFIVWAHHMFTVGLDVDTRAYFTAVTMIIAVPTGIKVFSWLATIHGSKIKYETPVLWALGFIFLFTTGGLTGIILSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIFAAFTHWFPLLTGLTLHHRWANAQFFLMFLGVNTTFFPQHFLGLSGMPRRYSDYPDAFMKWNVVSSFGSLLSFVALMLFIFILWEAFASQRSVISSPHMSSALEWSDPILPLDFHNLSETGIITYPK

COI

Cytochrome c oxidase subunit 1

512 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

56.814 kDa

MTQKWLFSTNHKDIGTLYFMFGAWAGMVGTSMSMIIRAELGQPGTMINDDQLYNVIITAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLTLLLMSSVVDNGAGTGWTVYPPLASVIAHSGASVDLAIFSLHLAGVSSILGAINFITTAINMRSNNMTLDQTPLFVWSVAITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHIVCQESGKIESFGTIGMIYAMLSIGLMGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKVFSWMATLYGTKFKFNPPLLWALGFIFLFTMGGLTGLVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGIIQWYPLFTGLTMNSKWLKIQFTIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTSWNVISSIGSTISITGIIMFILIMWESMIKQRNVFIWTNMSSSTEWLQNNPPAEHSYSELPLINL

COI

Cytochrome c oxidase subunit 1

512 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.126 kDa

MLPRWMYSTNHKDIGTMYLIFGAWSGMLGLSMSMLIRMELGQPGTLIGNDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPIMLGAPDMAFPRMNNMSFWLLPPSLFLLINSSLIESGAGTGWTVYPPLSSNLSHYGPSVDLAIFSLHLAGASSILGAINFITTIVNMRSIGMTMERMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNFNTSFFDPSGGGDPILYQHLFWFFGHPEVYILILPGFGMISQIICYNTGKKEPFGNLGMIYAMAAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGSHIKFNTSILWALGFVFLFTVGGLTGIMLANSSIDIVLHDTYYVVAHFHYVLSMGAVFGIMGAIIHWFPMFLGLNLNSMLTKVQFMITFIGVNLTFFPQHFLGLAGMPRRYSDYPDFFTKWNFISSLGSLISLMGVIMLIIIIWTSIIEKKMINFSSFTNSSIEWMLNFPPSEHSFNQNNIILK

COI

Cytochrome c oxidase subunit 1

512 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

56.492 kDa

MQRWFYSTNHKDIGTLYFIFGAWAGMVGTSLSMLIRAELGQPGSLIGDEQVYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPIMLGAPDMAFPRLNNLSFWMLPPSLTLLLASSMVESGAGTGWTVYPPLSSAIAHAGPSVDLAIFSLHLAGVSSILGAVNFITTIINMRPQSMSIDRMPLFVWAVGITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMVSHIISQESGKKEAFGTLGMIYAMLAIGILGFVVWAHHMFTVGMDVDTRAYFTAATMIIAIPTGIKIFSWIGTLHGTRLTMTPSMLWALGFVFLFTVGGLTGVVLSNSSIDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLMTGLSMNQFLLKVHFFIMFLGVNLTFFPQHFLGLAGMPRRYADYPDTYASWNVISSLGSVMSMIATLMFIFCIWEAMIAKRINIFSLNLSSSVEWNHPHPPADHSYEEITMISTF

COI

Cytochrome c oxidase subunit 1

509 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

57.034 kDa

MRWFYSTNHKDIGTLYMLFGIWCGMVGTGLSLLIRLELGTSGTLTDDHFYNVIVTAHAFVMIFFMVMPIMIGGFGNWMVPLLIGAPDMSFPRMNNMSFWLLPPAFILLICSSMVEGGAGTGWTVYPPLSSSLAHSGASVDLAIFSLHLAGMSSILGAINFITTIFNMRSPGMTMERVSLFVWSILVTVFLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHILGNSAMKQPFGTLGMIYAMISIGILGFIVWAHHMFTVGMDVDTRAYFTAATMIIAIPTGIKVFSWLMTIYGSKVQYTASMYWVLGFIFLFTLGGLTGIVLSNSSLDIMLHDTYYVVAHFHYVLSMGAVFAIFAGFNFWFPVMTGLILHERLAKAQFVVMFIAVNMTFFPQHFLGLAGMPRRYSDYPDSYFMWNQLSSYGSLMSVFAVLLFVLIVWEAFLSQRSLLFVDATLYSREWSDGYFPPDFHSNIYQSYITI

COI

Cytochrome c oxidase subunit 1

477 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

53.692 kDa

single

MVRWSRWFMANSHKDVGTMYLMLGMWSGFGGLNLSWMMRLELSRPGMWLPSSEVYNGIVTLHAIMMIFSFVMPVLIGGFGNWLLPMMLGSIDMSFPRLNTFSFWVLPPALYLVIVSCFIDYGSGTGWTMYPVPLSSTPYSGGISTDLMILGLHLAGISSSAESINYLVTFLNVRSKSFKAEFSPLFVWALAVTSFLLLVSLPVLAGGLTMLIMDRDFNCSFFDPSGGGDPVLFQHLFWFFGHPEVYVLILPGFGLVSHVLVFYTKKLRVFGSVAMMYAMISIGVLGFIVWGHHMYTVGLDVDTRFYFTAVTMLIAVPTGVKVFSWIATIYGSYLSFEAPTLWVLGFIMKFTMGGITGVILSNACLDVALHDTYYVVAHFHYVLSMGAVFTIFAGYIHYFPFFTSKLFSPVLARGHFFLTFVGVNLTFFPQHFLGLGGMPRRIPDYPIFYYYWNQWSTIGCAMVMVSVSLFIHMQWEA

COI

Cytochrome c oxidase subunit 1

476 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

52.729 kDa

MVLNRYALITNCNHKTLGLYYLWFSFLFGTYGFLLSVILRTELYSSSLRIIAQENVNLYNMIFTIHGIIMIFFNIMPGLFGGFGNYYLPILCGSSELAYPRINSISLLLQPIAFILVILSTAAEFGGGTGWTLYPPLSTSLMSLSPVAVDVIIIGLLVSGIASIMSSLNFVTTVLHLRAKGLSLGVLSVSTWSIIITSIMLLLTLPVLTGGVLMLLSDLHFNTLFFDPTFAGDPILYQHLFWFFGHPEVYILILPAFGVISHVISTNYCRSLFGNQSMILAMGCIAVLGSVVWVHHMYTTGLEVDTRAFFTSTTILISIPTGTKVFNWLCTYMSSNFGITHSSSLLCLLFICTFTFGGTTGVILGNGAIDIALHDTYYVIAHFHFVLSIGAIIALFTCVSFFQESFFGKTLRENTLIVLWSILFFIGVILTFLPMHFLGFNVMPRRIPDYPDALNGWNMICSIGSTMTLFGLLIFK

COI

Cytochrome c oxidase subunit 1

476 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

52.784 kDa

MVFNRYALITNCNHKTLGLYYLWFSFLFGIYGFLLSVILRTELYSSSLRIIAQENVNLYNMIFTVHGIIMIFFNIMPGLFGGFGNYYLPILCGSSELAYPRINSISLLLQPIAFILVILSTAAEFGGGTGWTWYPPLSTSLMSLSPVAVDVIVIGLLVSGIASIMSSLNFLTTVMHLRAKGLTLGILSVSTWSLIITSIMLLLTLPVLTGGVLMLLSDLHFNTLFFDPTFAGDPILYQHLLWFFGHPEVYILILPAFGIISHVISTNYSRSLFGNQSMILAMGCIAVLGSVVWVHHMYTTGLEVDTRAFFTSTTILISIPTGTKVFNWLCTYMSTNFGITHSSSLLSLLFICTFTFGGTTGVILGNGAIDVALHDTYYVIAHFHFVLSIGAIIALFTSVSFFQESFFGKTLRENTIIVLWSILFFVGVVLTFLPMHFLGFNVMPRRIPDYPDALNGWNMICSIGSTMTLFGLLIFK

COI

Cytochrome c oxidase subunit 1

340 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

38.174 kDa

single

MFWISLVCLSVSHKMIGMCYLLVAILCGFLGYIYSLFIRLELSIIGCGVLFGDYQYYNVLVTTHGLVMVFAFIMPVMMGGLVNYFVPVLSGFPDMVFPRLNNMSFWMFMGGFGALVSGLLTEEGMGIGWTMYPTLICVDFHSSLACDFTVFAVHLLGVSSILNSINLLGTLFCCRRKFFSFLNWTLFIWGSLITALLLIITLPVLAGGVTLVLCDRNFNTSFYDVVGGGDLLLFQHLFWFFGHPEVYIIIIPVFGLISTMVEVLGFRCVFSSVAMIYSMILIAILGFFVWAHHMFVVGMDVDTRAYFGSVTVLIGLPTCIKLFNWTYSFLYTDFIIAFEA

COI

Cytochrome c oxidase subunit 1

340 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

38.174 kDa

single

MFWISLVCLSVSHKMIGMCYLLVAILCGFLGYIYSLFIRLELSIIGCGVLFGDYQYYNVLVTTHGLVMVFAFIMPVMMGGLVNYFVPVLSGFPDMVFPRLNNMSFWMFMGGFGALVSGLLTEEGMGIGWTMYPTLICVDFHSSLACDFTVFAVHLLGVSSILNSINLLGTLFCCRRKFFSFLNWTLFIWGSLITALLLIITLPVLAGGVTLVLCDRNFNTSFYDVVGGGDLLLFQHLFWFFGHPEVYIIIIPVFGLISTMVEVLGFRCVFSSVAMIYSMILIAILGFFVWAHHMFVVGMDVDTRAYFGSVTVLIGLPTCIKLFNWTYSFLYTDFIIAFEA

COI

Cytochrome c oxidase subunit 1

274 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

30.928 kDa

single

PEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLAMNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDIYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

274 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

30.928 kDa

single

PEVYILILPGFGMISHIISQESGKKETFGCLGMIYAMMAIGLLGFVVWAHHMFTVGMDIDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQINYSPSMLWSLGFVFLFTVGGLTGVILANSSIDVTLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWYPLFTGLAMNPYLLKIQFFTMFIGVNLTFFPQHFLGLAGMPRRYSDYPDIYTSWNIISSLGSYISLIATMLMLMIIWESLINKRIILFPLNMNSSIEWYQNLPPAEHSYNELPILSNF

COI

Cytochrome c oxidase subunit 1

223 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

24.373 kDa

single

IGTLYFMFGIWAGLVGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGISSILGAINFITTIMNMRWEGLLMERLSLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLFWF

COI

Cytochrome c oxidase subunit 1

223 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

24.364 kDa

single

IGTLYFIFGIWSGLLGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFVMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNISHAGPSVDLAIFSLHLAGVSSILGAINFITTIMNMRWEGLQMERLPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLFWF

COI

Cytochrome c oxidase subunit 1

219 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

24.021 kDa

single

FPRMNNMSFWLLPPSLFLLIMSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFITTVINMRPMGMKLDRMPLFVWAVVITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESSKKEVFGTLGMIYAMMAIGLLGFIVWAHHMFTVGMDVDTQTYFTSATMII

COI

Cytochrome c oxidase subunit 1

219 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

23.87 kDa

single

TLYFIFGIWSGLLGTSLSLMIRSELGKPGTLLNDDQLYNVVVTAHGFIMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSAVESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLLLSXPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLF

COI

Cytochrome c oxidase subunit 1

219 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

24.021 kDa

single

FPRMNNMSFWLLPPSLFLLIMSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFITTVINMRPMGMKLDRMPLFVWAVVITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESSKKEVFGTLGMIYAMMAIGLLGFIVWAHHMFTVGMDVDTQTYFTSATMII

COI

Cytochrome c oxidase subunit 1

219 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

23.87 kDa

single

TLYFIFGIWSGLLGTSLSLMIRSELGKPGTLLNDDQLYNVVVTAHGFIMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSAVESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLLLSXPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLF

COI

Cytochrome c oxidase subunit 1

219 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

23.945 kDa

single

TLYFIFGIWSGLLGTSLSLMIRTELGQPGSLLNDDQLYNVIVTAHAFVMIFFLVMPVMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSAPVESGAGTGWTVYPPLSSNLAHMGPSVDLAIFSLHLAGISSIPGAINFITTIINMRWEGMMMERLPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLF

COI

Cytochrome c oxidase subunit 1

213 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

23.084 kDa

single

IFGIWAGLVGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGISSILGAINFITTIMNMRWEGLLMERMSLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQH

COI

Cytochrome c oxidase subunit 1

209 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

22.607 kDa

single

GIWSGLLGTSLSLMIRTELGQPGSLLNDDQLYNVIVTAHAFVMIFFLVMPVMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSAAVESGAGTGWTVYPPLSSNLAHMGPSVDLAIFSLHLAGISSILGAINFITTIINMRWEGMLMERLPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILY

COI

Cytochrome c oxidase subunit 1

207 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

22.303 kDa

single

IFGIWAGLLGTSLSLMIRTELGQPGSLLNDDQLYNVVVTAHGFIMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGLQMERLPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGD

COI

Cytochrome c oxidase subunit 1

195 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

22.648 kDa

single

IYGSKVQYTASMYWVLGFIFLFTLGGLTGIVLSNSSLDIMLHDTYYVVAHFHYVLSMGAVFAIFAGFNFWFPVMTGLVLHERLAKAQFIVMFIAVNMTFFPQHFLGLAGMPRRYSDYPDSYFMWNQLSSYGSLMSVFAVLLFVLIVWEAFLSQRSLLFVDATLYSREWSDGYFPPDFHSNIYQSYITIYKTYYSK