Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.

Belongs to the heme-copper respiratory oxidase family.

single

223 amino acids

IGTLYFIFGIWSGLLGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFVMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNISHAGPSVDLAIFSLHLAGVSSILGAINFITTIMNMRWEGLQMERLPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHLFWF

24.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make COI using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here