cckar

Cholecystokinin receptor

453 amino acids

Receptor for cholecystokinin. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Has high affinity for CCK-8 and low affinities for gastrin-17-I, CCK-4, and unsulfated CCK-8.

Belongs to the G-protein coupled receptor 1 family.

51.157 kDa

MESLRSLSNISALHELLCRYSNLSGTLTWNLSSTNGTHNLTTANWPPWNLNCTPILDRKKPSPSDLNLWVRIVMYSVIFLLSVFGNTLIIIVLVMNKRLRTITNSFLLSLALSDLMVAVLCMPFTLIPNLMENFIFGEVICRAAAYFMGLSVSVSTFNLVAISIERYSAICNPLKSRVWQTRSHAYRVIAATWVLSSIIMIPYLVYNKTVTFPMKDRRVGHQCRLVWPSKQVQQAWYVLLLTILFFIPGVVMIVAYGLISRELYRGIQFEMDLNKEAKAHKNGVSTPTTIPSGDEGDGCYIQVTKRRNTMEMSTLTPSVCTKMDRARINNSEAKLMAKKRVIRMLIVIVAMFFICWMPIFVANTWKAFDELSAFNTLTGAPISFIHLLSYTSACVNPLIYCFMNKRFRKAFLGTFSSCIKPCRNFRDTDEDIAATGASLSKFSYTTVSSLGPA

Cckar

Cholecystokinin receptor type A

444 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

49.657 kDa

MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQILLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVMVVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQLSSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEEDGRTIRALLSRYSYSHMSTSAPPP

Cckar

Cholecystokinin receptor type A

436 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

48.437 kDa

MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGIKFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGRINRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRASLSRYSYSHMSTSAPPH

CCKAR

Cholecystokinin receptor type A

430 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

48.211 kDa

MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRSSSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSYSHMSTSAPPP

CCKAR

Cholecystokinin receptor type A

428 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

47.836 kDa

MEVADSLLGNGSDVPPPCELGLENETLVCLEQPRAAKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIATTWCLSFTIMTPYPIYSNLVPFTKTNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFDAIQKKSARDRNPSTGSSGRYEDGDGCYLQKARPRRRLELRQLSTPGSGRLNRIRSTSSTANLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFLATFPCCPHPGPPGPRGEVGEEEEGRTTGASLSRYSYSHMSASAPGP

CCKAR

Cholecystokinin receptor type A

428 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Belongs to the G-protein coupled receptor 1 family.

47.841 kDa

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ

CCKAR

Cholecystokinin receptor type A

427 amino acids

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).

Belongs to the G-protein coupled receptor 1 family.

47.387 kDa

MDAVASLLGNASGIPPPCELGLDNETLFCLDQPPPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAISDLMLCLFCMPFNLIPNLLKDFIFGSALCKTTTYLMGTSVSVSTLNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFAIMTPYPIYSNLVPFTKTNNQTANMCRFLLPSDVMQQAWHTFLLLILFLIPGIVMMVAYGMISLELYQGIKFDASQKKSAKERKASTGSGRFEDNDGCYLQRSKPTRQLELQQLSGGGGGRVSRIRSSSSAATLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTVSAERRLSGTPISFILLLSYTSSCVNPIIYCFMNRRFRLGFMATFPCCPNPGPPGPRAEAGEEEEGRTTRASLSRYSYSHMSASAPPS