About Products Protein Database Contact

Protein expression services for CCKAR | Cholecystokinin receptor type A

Description
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (By similarity).
Family
Belongs to the G-protein coupled receptor 1 family.
Species
Oryctolagus cuniculus
Length
427 amino acids
Sequence
MDAVASLLGNASGIPPPCELGLDNETLFCLDQPPPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAISDLMLCLFCMPFNLIPNLLKDFIFGSALCKTTTYLMGTSVSVSTLNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFAIMTPYPIYSNLVPFTKTNNQTANMCRFLLPSDVMQQAWHTFLLLILFLIPGIVMMVAYGMISLELYQGIKFDASQKKSAKERKASTGSGRFEDNDGCYLQRSKPTRQLELQQLSGGGGGRVSRIRSSSSAATLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTVSAERRLSGTPISFILLLSYTSSCVNPIIYCFMNRRFRLGFMATFPCCPNPGPPGPRAEAGEEEEGRTTRASLSRYSYSHMSASAPPS
Mass
47.4 kDa
Simulated SDS-PAGE
Western blot of CCKAR recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CCKAR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here