Receptor for cholecystokinin. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Has high affinity for CCK-8 and low affinities for gastrin-17-I, CCK-4, and unsulfated CCK-8.

Belongs to the G-protein coupled receptor 1 family.

453 amino acids

MESLRSLSNISALHELLCRYSNLSGTLTWNLSSTNGTHNLTTANWPPWNLNCTPILDRKKPSPSDLNLWVRIVMYSVIFLLSVFGNTLIIIVLVMNKRLRTITNSFLLSLALSDLMVAVLCMPFTLIPNLMENFIFGEVICRAAAYFMGLSVSVSTFNLVAISIERYSAICNPLKSRVWQTRSHAYRVIAATWVLSSIIMIPYLVYNKTVTFPMKDRRVGHQCRLVWPSKQVQQAWYVLLLTILFFIPGVVMIVAYGLISRELYRGIQFEMDLNKEAKAHKNGVSTPTTIPSGDEGDGCYIQVTKRRNTMEMSTLTPSVCTKMDRARINNSEAKLMAKKRVIRMLIVIVAMFFICWMPIFVANTWKAFDELSAFNTLTGAPISFIHLLSYTSACVNPLIYCFMNKRFRKAFLGTFSSCIKPCRNFRDTDEDIAATGASLSKFSYTTVSSLGPA

51.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cckar using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here