ANP32E

Acidic leucine-rich nuclear phosphoprotein 32 family member E

268 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state (PubMed:24463511). Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis.

Belongs to the ANP32 family.

30.692 kDa

MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD

anp32e

Acidic leucine-rich nuclear phosphoprotein 32 family member E

263 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis (By similarity).

Belongs to the ANP32 family.

30.108 kDa

MEMKKRISLELRNRSPAEVAELVLDNCRSVDGEIEGLNDSYKELEFLSMANVELKSLSKLPKLPKLRKLELSDNSISGGLDVLTERCPNITYLNLSGNKIKDLSTVEALASLKNLKSLDLFNCEITNLEDYRENIFQRLSQITYLDGFDQEDNEAPDSEEDDDDDDYDDDEEPGPRRYEAEEDEEDEESASDLGEEEEEEEEVGLSYLMKEEIRDEEDDDDYVEDGAEGEEEEEEDEEDEAAAADQGEKRKRDPEDEGDEDED

Anp32e

Acidic leucine-rich nuclear phosphoprotein 32 family member E

260 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state (PubMed:24463511). Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis.

Belongs to the ANP32 family.

29.622 kDa

MEMKKKINMELKNRAPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDDDEDGDEDEEDEDEDEAGPPEGYEEEEDDDEDEAGSEVGEGEEEVGLSYLMKDEIQDEEDDDDYVDEGEEEEEEEEEGLRGEKRKRDAEDDGEEDDD

Anp32e

Acidic leucine-rich nuclear phosphoprotein 32 family member E

258 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis (By similarity).

Belongs to the ANP32 family.

29.418 kDa

MEMKKKINMELKNRAPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEEEDEDGDEDEEDEEEDEAGPPEGYEDEDEDEDEAGSEVGEGEEEVGLSYLMKEEIQDEEDDDDYVDEGEEEEEEEEEGPRGEKRKRDAEDDGEEDDD

ANP32E

Acidic leucine-rich nuclear phosphoprotein 32 family member E

256 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis (By similarity).

Belongs to the ANP32 family.

28.926 kDa

MEMKKRINLELRNQAPEEVTELVLDNCKSSNGEIEGLNDSFKELEFLSMANVQLTSLAKLPTLSKLRKLELSDNIISGGLEVLAERCPNLTYLNLSGNKIKDLGTVEALQNLKNLKSLDLFNCEITNLEDYRDSIFDLLQQITYLDGFDQEDNEAPDSEDDDDEGDEDDNDEDEDEAGPPGEYEEEDDEDDGGSDLGEGEEEEEVGLSYLMKEEIQDEDDDDDYVEEGGDEEEEAEGIRGEKRKRDPEDEGEEEDD

anp32e

Acidic leucine-rich nuclear phosphoprotein 32 family member E

250 amino acids

Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis (By similarity).

Belongs to the ANP32 family.

28.135 kDa

MEMKKRISLELRNRTPAEVAELVVDNCRSSDGEIEGLTDDFKELEFLSMVNVGLTSLAKLPSLPKLRKLELSDNNISGTLETLAEKCANLTYLNLSGNKIKELSTLEALQNLKNLKSLDLFNCEITTLEDYRESIFELLPQVTYLDGFDAEDNEAPDSEADDDDDDEDGDEGAGQLGEYEEEEEEDEEGSEGGEVGLSYLMKEDIQDEEDDDDYVEEEEEEGGEEEADVRGEKRKREAEDEGEDDDEDDD