About Products Protein Database Contact

Protein expression services for ANP32E | Acidic leucine-rich nuclear phosphoprotein 32 family member E

Description
Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state. Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis (By similarity).
Family
Belongs to the ANP32 family.
Species
Gallus gallus
Length
256 amino acids
Sequence
MEMKKRINLELRNQAPEEVTELVLDNCKSSNGEIEGLNDSFKELEFLSMANVQLTSLAKLPTLSKLRKLELSDNIISGGLEVLAERCPNLTYLNLSGNKIKDLGTVEALQNLKNLKSLDLFNCEITNLEDYRDSIFDLLQQITYLDGFDQEDNEAPDSEDDDDEGDEDDNDEDEDEAGPPGEYEEEDDEDDGGSDLGEGEEEEEVGLSYLMKEEIQDEDDDDDYVEEGGDEEEEAEGIRGEKRKRDPEDEGEEEDD
Mass
28.9 kDa
Simulated SDS-PAGE
Western blot of ANP32E recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ANP32E using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here